BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_F24 (935 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Sc... 41 3e-04 SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|S... 33 0.044 >SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Schizosaccharomyces pombe|chr 1|||Manual Length = 109 Score = 40.7 bits (91), Expect = 3e-04 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = +1 Query: 211 DDDVXVXGEKIXXILKXXXVDVEXYWXGXXXKXLEGXNVXXXFINXGXGVGXXXXXGG 384 D+ + + +K+ + K VDVE W K LEG ++ +N G G G GG Sbjct: 17 DEGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLKELLLNIGSGAGAAPVAGG 74 >SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 33.5 bits (73), Expect = 0.044 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +1 Query: 211 DDDVXVXGEKIXXILKXXXVDVEXYWXGXXXKXLEGXNVXXXFINXG 351 D+ + + +K+ + K VDVE W K LEG ++ +N G Sbjct: 17 DEGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLKELLLNIG 63 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 675,299 Number of Sequences: 5004 Number of extensions: 4030 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 475330268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -