BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_F23 (899 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0292 + 22846273-22846377,22847161-22847823 29 6.7 06_02_0336 + 14613185-14613610,14615746-14615892,14615976-14616302 28 8.8 04_04_0234 - 23805383-23805502,23805652-23805733,23805820-238060... 28 8.8 >03_05_0292 + 22846273-22846377,22847161-22847823 Length = 255 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 65 ACGCLCFFVAFASGYVDKGSPPQWSQY 145 ACGC+ F A G V + P+W ++ Sbjct: 196 ACGCMAEFAEVADGAVTPFARPRWDEF 222 >06_02_0336 + 14613185-14613610,14615746-14615892,14615976-14616302 Length = 299 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +2 Query: 155 RDSLNIPYAELHEPFYAWYDSKXSXSRIDYYGGMVXTYQFTSAVYPPYGXL 307 RD + A H FY Y + R++Y G V T + V+ YG L Sbjct: 51 RDKALVEEALTHGSFYYPYRPGVTYERLEYLGDAVLTCVVSREVFLTYGQL 101 >04_04_0234 - 23805383-23805502,23805652-23805733,23805820-23806088, 23806384-23806524,23806751-23806936,23807186-23807422, 23807505-23807720,23807816-23808146,23808257-23808369, 23808691-23808996,23809078-23809187,23810226-23810363, 23811230-23811497 Length = 838 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +3 Query: 96 SHLDMSIKGRHHNGVSIHSKGTP*IYPMLNCMSHSMLGTTVR 221 S + + +G HH G I S+ P + P ++ M ++ TV+ Sbjct: 246 SEVHAATRGGHHRGKVISSEVVPEVQPAMDAMEYAECEATVK 287 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,852,746 Number of Sequences: 37544 Number of extensions: 173648 Number of successful extensions: 331 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 331 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2542098580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -