BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_F22 (949 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12G12.04 |hsp60|hsp60|mitochondrial heat shock protein Hsp60... 29 0.96 SPBP23A10.14c |ell1||RNA polymerase II transcription elongation ... 27 2.9 SPAC4G9.04c |||cleavage and polyadenylation specificity factor |... 27 5.1 SPCC364.07 ||SPCC4G3.01|D-3 phosphoglycerate dehydrogenase |Schi... 26 8.9 SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||M... 26 8.9 >SPAC12G12.04 |hsp60|hsp60|mitochondrial heat shock protein Hsp60|Schizosaccharomyces pombe|chr 1|||Manual Length = 582 Score = 29.1 bits (62), Expect = 0.96 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 405 AKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFINSGVL 533 AK G ++ VGG ++ E EK + ++++ A A ++ GVL Sbjct: 402 AKLSGGIAVIKVGGSSEVEVNEKKDRIVDALNAVKAAVSEGVL 444 >SPBP23A10.14c |ell1||RNA polymerase II transcription elongation factor SpELL|Schizosaccharomyces pombe|chr 2|||Manual Length = 533 Score = 27.5 bits (58), Expect = 2.9 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 508 LLSLIPECCWLNNMVSMELTSP 573 L +L+PE W NNM EL +P Sbjct: 227 LQALLPEVAWKNNMNQWELLNP 248 >SPAC4G9.04c |||cleavage and polyadenylation specificity factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 638 Score = 26.6 bits (56), Expect = 5.1 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -1 Query: 571 ARSIPSKPYC--SANSTPELMKAVRACCDSSRRLYFSGSSVSASPPTDNNTVRPG 413 A S PS P S +STP + ++ + + Y +SVS+ PP ++ V PG Sbjct: 277 ATSAPSVPSALSSISSTPFMKPSIPSTIPTIPSAY--SASVSSQPPLTHSYVHPG 329 >SPCC364.07 ||SPCC4G3.01|D-3 phosphoglycerate dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 466 Score = 25.8 bits (54), Expect = 8.9 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +3 Query: 363 DRTHDNYRAITSLKAKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFINSG 527 D+ D+ + TS + + +GG TEE + YN+ +E +A T +IN G Sbjct: 320 DKFVDSLNSWTSELTHCKNIILTPHIGGS--TEEAQ-YNIGIEVSEALTRYINEG 371 >SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1258 Score = 25.8 bits (54), Expect = 8.9 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -1 Query: 544 CSANSTPELMKAVRACCDSSRRLYFSGS 461 C NST + M V C D RLY G+ Sbjct: 652 CEFNSTRKRMSIVFRCPDGKIRLYVKGA 679 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,713,215 Number of Sequences: 5004 Number of extensions: 47393 Number of successful extensions: 118 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 483319012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -