BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_F18 (882 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 27 0.15 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 9.7 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 21 9.7 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 27.5 bits (58), Expect = 0.15 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +2 Query: 413 CSAGRVCEINEHGDAMCNCIKDCPYETDSRRMVCTNFNETWQSDC 547 C G VC I++ G +C DCP T+ NE + C Sbjct: 385 CQNGGVCRISDGGGYIC----DCPSGTNGTNCEIDTINECDSNPC 425 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 287 SLDEKRYHEAEIARV 331 SLDEK+Y E+ RV Sbjct: 334 SLDEKKYILQEVVRV 348 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.4 bits (43), Expect = 9.7 Identities = 11/42 (26%), Positives = 15/42 (35%) Frame = +2 Query: 470 IKDCPYETDSRRMVCTNFNETWQSDCXVYRQRCLCLDNSDQC 595 I DC C + +Q C + LC N+D C Sbjct: 69 INDCKVNPCENGGTCVDKINAFQCICKEGWEGALCNINTDDC 110 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,008 Number of Sequences: 336 Number of extensions: 3439 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24410188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -