BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_F18 (882 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 42 1e-05 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 26 0.53 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 24 2.1 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 41.5 bits (93), Expect = 1e-05 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +2 Query: 395 PCLKVHCSAGRVCEINEHGD-AMCNCIKDCPYETDSRRMVCTNFNETWQSDCXVYRQRC 568 PC +C G+ CE++ + A+C C++ CP R VC + + + + C ++R C Sbjct: 81 PCASKYCGIGKECELSPNSTIAVCVCMRKCPRR---HRPVCASNGKIYANHCELHRAAC 136 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.8 bits (54), Expect = 0.53 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 Query: 425 RVCEINEHGDAMCNCIKDCPYETDSRRMVCTNFNET 532 +VC H D+ C C+ DS V NFNE+ Sbjct: 344 QVCRSRRHSDSCCLCL-------DSMNAVIRNFNES 372 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.8 bits (49), Expect = 2.1 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +2 Query: 416 SAGRVCEINEHGDAMCNCIKDCPYETDSRRMVC 514 + G C EH + DC E +RR +C Sbjct: 296 TTGTKCVSGEHLSVSGGALNDCHAEVVARRCLC 328 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,801 Number of Sequences: 438 Number of extensions: 3696 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28644972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -