BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_F14 (885 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P13276 Cluster: Apolipophorin-3 precursor; n=11; Ditrys... 94 4e-18 >UniRef50_P13276 Cluster: Apolipophorin-3 precursor; n=11; Ditrysia|Rep: Apolipophorin-3 precursor - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 189 Score = 94.3 bits (224), Expect = 4e-18 Identities = 63/154 (40%), Positives = 72/154 (46%), Gaps = 3/154 (1%) Frame = +1 Query: 193 AMVRREXPX---FFXDXEHHTKEFHXTLQXXCNSLTKSKDAQDFRKAWKXGSXIRAXTAQ 363 AMVRR+ P F + E H KEF T NSL SK+ QDF KA K GS Sbjct: 19 AMVRRDAPAGGNAFEEMEKHAKEFQKTFSEQFNSLVNSKNTQDFNKALKDGSDSVLQQLS 78 Query: 364 RLRQESPVXRSXTRTERPXXLWNXXXXXXXXXXXXXXXPTLDVXKNAXXLREKLQAAVXN 543 S + L DV K A ++KLQAAV Sbjct: 79 AFSSSLQGAISDANGKAKEALEQARQNVEKTAEELRKAHP-DVEKEANAFKDKLQAAVQT 137 Query: 544 TVQESQKLANXVSSNVXETNEKLAPKIKXXYXDF 645 TVQESQKLA V+SN+ ETN+KLAPKIK Y DF Sbjct: 138 TVQESQKLAKEVASNMEETNKKLAPKIKQAYDDF 171 Score = 41.1 bits (92), Expect = 0.036 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = +3 Query: 390 ALXXANGKAXXALEQSRQNI*RTVEELRK 476 A+ ANGKA ALEQ+RQN+ +T EELRK Sbjct: 87 AISDANGKAKEALEQARQNVEKTAEELRK 115 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 443,908,929 Number of Sequences: 1657284 Number of extensions: 4963784 Number of successful extensions: 7620 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 7523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7619 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 79522270534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -