BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_F09 (884 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 3e-19 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 6e-19 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 8e-19 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 8e-19 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 8e-19 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 3e-18 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 3e-18 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 3e-18 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 5e-17 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 84 1e-16 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 84 2e-16 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 84 2e-16 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 82 7e-16 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 6e-14 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 51 1e-06 SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 50 3e-06 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_21487| Best HMM Match : MAM (HMM E-Value=0) 49 4e-06 SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) 49 4e-06 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 49 4e-06 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) 49 6e-06 SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 6e-06 SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) 49 6e-06 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 47 2e-05 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 42 5e-04 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 42 7e-04 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 42 7e-04 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 42 7e-04 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 42 7e-04 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 42 7e-04 SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) 42 7e-04 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 42 7e-04 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 42 9e-04 SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 41 0.002 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 41 0.002 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 41 0.002 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 41 0.002 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 41 0.002 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 41 0.002 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 41 0.002 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 41 0.002 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 41 0.002 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 41 0.002 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 41 0.002 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 41 0.002 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 41 0.002 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 41 0.002 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 41 0.002 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 41 0.002 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 41 0.002 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 41 0.002 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 41 0.002 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 41 0.002 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 41 0.002 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 41 0.002 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 41 0.002 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 41 0.002 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 41 0.002 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 41 0.002 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 41 0.002 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 41 0.002 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 41 0.002 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 41 0.002 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 41 0.002 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 41 0.002 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 41 0.002 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 41 0.002 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 41 0.002 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 41 0.002 SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 41 0.002 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 41 0.002 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 41 0.002 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 41 0.002 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.002 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 41 0.002 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 41 0.002 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 41 0.002 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 41 0.002 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 41 0.002 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 41 0.002 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 41 0.002 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 41 0.002 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 41 0.002 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 41 0.002 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 41 0.002 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 41 0.002 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 41 0.002 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 41 0.002 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 41 0.002 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 41 0.002 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 41 0.002 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 41 0.002 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 41 0.002 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 41 0.002 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 41 0.002 SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 41 0.002 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 41 0.002 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 41 0.002 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 41 0.002 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 41 0.002 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 41 0.002 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 41 0.002 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.002 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 41 0.002 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 41 0.002 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 41 0.002 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57198| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 41 0.002 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54385| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.002 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 41 0.002 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 41 0.002 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 41 0.002 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51677| Best HMM Match : DUF327 (HMM E-Value=0.89) 41 0.002 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50879| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50740| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50212| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.002 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49154| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46319| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 41 0.002 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 41 0.002 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 41 0.002 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 41 0.002 SB_45133| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44633| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 41 0.002 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42693| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 41 0.002 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40779| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 41 0.002 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 41 0.002 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 41 0.002 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 41 0.002 SB_39135| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 41 0.002 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 41 0.002 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 41 0.002 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 41 0.002 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 41 0.002 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 41 0.002 SB_36097| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 41 0.002 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 93.1 bits (221), Expect = 3e-19 Identities = 44/62 (70%), Positives = 44/62 (70%) Frame = -1 Query: 635 QGXGAYGKTPXTRPFYGSXPFXGLLLTCSFLRYPLILWITVXXXXXXXXXXXXXERPSXA 456 QG GAYGKTP TRPFYGS PF GLLLTCSFLRYPLILWITV ERPS A Sbjct: 22 QGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAA 81 Query: 455 SQ 450 SQ Sbjct: 82 SQ 83 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 91.9 bits (218), Expect = 6e-19 Identities = 43/62 (69%), Positives = 44/62 (70%) Frame = -1 Query: 635 QGXGAYGKTPXTRPFYGSXPFXGLLLTCSFLRYPLILWITVXXXXXXXXXXXXXERPSXA 456 +G GAYGKTP TRPFYGS PF GLLLTCSFLRYPLILWITV ERPS A Sbjct: 405 EGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAA 464 Query: 455 SQ 450 SQ Sbjct: 465 SQ 466 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 91.5 bits (217), Expect = 8e-19 Identities = 41/49 (83%), Positives = 41/49 (83%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE*XD 490 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE D Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYGD 64 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 91.5 bits (217), Expect = 8e-19 Identities = 43/62 (69%), Positives = 44/62 (70%) Frame = -1 Query: 635 QGXGAYGKTPXTRPFYGSXPFXGLLLTCSFLRYPLILWITVXXXXXXXXXXXXXERPSXA 456 +G GAYGKTP TRPFYGS PF GLLLTCSFLRYPLILWITV ERPS A Sbjct: 758 RGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAA 817 Query: 455 SQ 450 SQ Sbjct: 818 SQ 819 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 91.5 bits (217), Expect = 8e-19 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = -3 Query: 639 SSGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 +SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 57 NSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 103 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 91.1 bits (216), Expect = 1e-18 Identities = 43/61 (70%), Positives = 43/61 (70%) Frame = -1 Query: 632 GXGAYGKTPXTRPFYGSXPFXGLLLTCSFLRYPLILWITVXXXXXXXXXXXXXERPSXAS 453 G GAYGKTP TRPFYGS PF GLLLTCSFLRYPLILWITV ERPS AS Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 60 Query: 452 Q 450 Q Sbjct: 61 Q 61 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 91.1 bits (216), Expect = 1e-18 Identities = 43/61 (70%), Positives = 43/61 (70%) Frame = -1 Query: 632 GXGAYGKTPXTRPFYGSXPFXGLLLTCSFLRYPLILWITVXXXXXXXXXXXXXERPSXAS 453 G GAYGKTP TRPFYGS PF GLLLTCSFLRYPLILWITV ERPS AS Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 83 Query: 452 Q 450 Q Sbjct: 84 Q 84 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.1 bits (216), Expect = 1e-18 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 89.8 bits (213), Expect = 3e-18 Identities = 39/46 (84%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT F+ Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFD 61 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 89.8 bits (213), Expect = 3e-18 Identities = 39/46 (84%), Positives = 40/46 (86%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 +GGRSLWKN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 92 AGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 137 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 89.4 bits (212), Expect = 3e-18 Identities = 42/61 (68%), Positives = 42/61 (68%) Frame = -1 Query: 632 GXGAYGKTPXTRPFYGSXPFXGLLLTCSFLRYPLILWITVXXXXXXXXXXXXXERPSXAS 453 G GAYGKTP TRPFYGS PF GLLLTCSFLRYPLILWITV ERPS A Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAK 60 Query: 452 Q 450 Q Sbjct: 61 Q 61 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 89.0 bits (211), Expect = 4e-18 Identities = 42/66 (63%), Positives = 44/66 (66%) Frame = -1 Query: 650 FXXAXQGXGAYGKTPXTRPFYGSXPFXGLLLTCSFLRYPLILWITVXXXXXXXXXXXXXE 471 F +G GAYGKTP TRPFYGS PF GLLLTCSFLRYPLILWITV E Sbjct: 549 FVLRGKGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAE 608 Query: 470 RPSXAS 453 RPS A+ Sbjct: 609 RPSAAT 614 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 85.8 bits (203), Expect = 4e-17 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = -3 Query: 630 GRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 GRSLWKN N AFLRFL F WPFAHMF+PALSPDSVDNRIT FE Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAFE 45 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 85.4 bits (202), Expect = 5e-17 Identities = 38/46 (82%), Positives = 38/46 (82%) Frame = -3 Query: 636 SGGRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 SGGRSLWKN N AFLRFL F WPFAHMFF ALSPD VDNRIT FE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAFE 61 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 84.2 bits (199), Expect = 1e-16 Identities = 40/57 (70%), Positives = 42/57 (73%) Frame = +3 Query: 525 QNQGITQERTCEQKAXKRXGTVKRPXXWXFSIGSXPLXSXXKXXXQVRGGETXRXIK 695 +NQGITQERTCEQKA KR GTVKRP W FSIGS PL S K QVRGGET + K Sbjct: 114 KNQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYK 170 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 706 FPXGXSXXALXXRXXXLXDXCXXFXLXEXWXFXIXXAVGI 825 FP AL R L D C F L E W F I AV I Sbjct: 175 FPLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVAI 214 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 83.8 bits (198), Expect = 2e-16 Identities = 39/43 (90%), Positives = 39/43 (90%) Frame = +3 Query: 378 CINESANARGEAVCVLGALPXPRSLTRXARSFGXGERYQXTQR 506 CINESANARGEAVCVLGALP PRSLTR ARSFG GERYQ TQR Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQR 142 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 83.8 bits (198), Expect = 2e-16 Identities = 39/43 (90%), Positives = 39/43 (90%) Frame = +3 Query: 378 CINESANARGEAVCVLGALPXPRSLTRXARSFGXGERYQXTQR 506 CINESANARGEAVCVLGALP PRSLTR ARSFG GERYQ TQR Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQR 506 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 83.8 bits (198), Expect = 2e-16 Identities = 40/56 (71%), Positives = 41/56 (73%) Frame = +3 Query: 528 NQGITQERTCEQKAXKRXGTVKRPXXWXFSIGSXPLXSXXKXXXQVRGGETXRXIK 695 NQGITQERTCEQKA KR GTVKRP W FSIGS PL S K QVRGGET + K Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYK 141 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = +1 Query: 706 FPXGXSXXALXXRXXXLXDXCXXFXLXEXWXFXIXXAVGIXXXCRLXXXXWGCVXKPP 879 FP AL R L D C F L E W F I AVGI CR W PP Sbjct: 146 FPLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPP 203 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 81.8 bits (193), Expect = 7e-16 Identities = 44/76 (57%), Positives = 44/76 (57%) Frame = -3 Query: 630 GRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE*XDTAXXXRTTXXXXX 451 GRSLWKN N AFLRFL F WPF HMF PALSPDSVD IT FE D A R Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFERDDIARSSRMHERRES 61 Query: 450 XXXXXXERPIRKPPLP 403 ER IRK LP Sbjct: 62 VSEEAEERSIRKQTLP 77 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 75.4 bits (177), Expect = 6e-14 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 630 GRSLWKNXXNXAFLRFLXFXWPFAHMFFPALSPDSVDNRITXFE 499 G KN N AFLRFL F WPFAHMFFPALSPDSVDNRIT FE Sbjct: 18 GAEPMKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKNM 556 VVR AVS HSK VIRLSTESGDNAGKNM Sbjct: 72 VVRLRRAVSAHSKAVIRLSTESGDNAGKNM 101 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKNM 556 VVR AVS HSK VIRLSTESGDNAGKNM Sbjct: 594 VVRLRRAVSAHSKAVIRLSTESGDNAGKNM 623 >SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKNM 556 VVR AVS HSK VIRLSTESGDNAGKNM Sbjct: 26 VVRLRRAVSAHSKAVIRLSTESGDNAGKNM 55 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKNM 556 VVR AVS HSK VIRLSTESGDNAGKNM Sbjct: 21 VVRLRRAVSAHSKAVIRLSTESGDNAGKNM 50 >SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKNM 556 VVR AVS HSK VIRLSTESGDNAGKNM Sbjct: 159 VVRLRRAVSAHSKAVIRLSTESGDNAGKNM 188 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 49.6 bits (113), Expect = 3e-06 Identities = 38/94 (40%), Positives = 44/94 (46%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGERYQXTQRX*YGYPQNQGITQERTCEQKAXKRXGTVK 593 +C G +P PRSLTR ARSF GER T G E +K R V+ Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT--------NGGGDFLEDA--RKILNR--EVR 144 Query: 594 RPXXWXFSIGSXPLXSXXKXXXQVRGGETXRXIK 695 P FSIGS PL S K Q+ GGET + K Sbjct: 145 GPRQSRFSIGSAPLTSITKSDAQISGGETRQDYK 178 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 49.6 bits (113), Expect = 3e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKNM*AKGQXK 577 VVR AVS HSK VIRLSTESGDNAGKN+ + + K Sbjct: 228 VVRLRRAVSAHSKAVIRLSTESGDNAGKNICLEDELK 264 >SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 49.6 bits (113), Expect = 3e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKNM*AK 565 VVR AVS HSK VIRLSTESGDNAGKN+ A+ Sbjct: 21 VVRLRRAVSAHSKAVIRLSTESGDNAGKNIDAE 53 >SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKNM 556 VVR AVS HSK VIRLSTESGDNAGKN+ Sbjct: 467 VVRLRRAVSAHSKAVIRLSTESGDNAGKNI 496 >SB_21487| Best HMM Match : MAM (HMM E-Value=0) Length = 874 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKNM 556 VVR AVS HSK VIRLSTESGDNAGKN+ Sbjct: 80 VVRLRRAVSAHSKAVIRLSTESGDNAGKNI 109 >SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) Length = 492 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKNM 556 VVR AVS HSK VIRLSTESGDNAGKN+ Sbjct: 328 VVRLRRAVSAHSKAVIRLSTESGDNAGKNI 357 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKNM 556 VVR AVS HSK VIRLSTESGDNAGKN+ Sbjct: 55 VVRLRRAVSAHSKAVIRLSTESGDNAGKNI 84 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKNM 556 VVR AVS HSK VIRLSTESGDNAGKN+ Sbjct: 282 VVRLRRAVSAHSKAVIRLSTESGDNAGKNI 311 >SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) Length = 302 Score = 48.8 bits (111), Expect = 6e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKN 553 VVR AVS HSK VIRLSTESGDNAGKN Sbjct: 273 VVRLRRAVSAHSKAVIRLSTESGDNAGKN 301 >SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 48.8 bits (111), Expect = 6e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKN 553 VVR AVS HSK VIRLSTESGDNAGKN Sbjct: 18 VVRLRRAVSAHSKAVIRLSTESGDNAGKN 46 >SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) Length = 117 Score = 48.8 bits (111), Expect = 6e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKN 553 VVR AVS HSK VIRLSTESGDNAGKN Sbjct: 88 VVRLRRAVSAHSKAVIRLSTESGDNAGKN 116 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 467 VVRXXXAVSXHSKXVIRLSTESGDNAGKNM 556 VVR A S HSK VIRLSTESGDNAGKN+ Sbjct: 21 VVRLRRAESAHSKAVIRLSTESGDNAGKNI 50 >SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) Length = 225 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +1 Query: 313 LTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 + +I +++ F V +ALMNRPTRGERRFAYW Sbjct: 157 IPVSIVYLVSFEMYVGKPVVPAALMNRPTRGERRFAYW 194 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +1 Query: 325 IAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 I+F FR V V +ALMNRPTRGERRFAYW Sbjct: 130 ISFTRIFRVGKPV--VPAALMNRPTRGERRFAYW 161 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 197 ICDTGYIPLPRSLTRYARSFDCGER 221 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGERYQXTQR 506 +C G +P PRSLTR ARSF GER +R Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKMAYER 107 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) Length = 996 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) Length = 183 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) Length = 336 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 304 INKLTTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/41 (51%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 310 KLTTTIAFILCFRFRXEVWE--VFSALMNRPTRGERRFAYW 426 ++ T + C R+ V + V +ALMNRPTRGERRFAYW Sbjct: 58 EIETNFSTNRCRRYMATVGKPVVPAALMNRPTRGERRFAYW 98 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGER 158 >SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.5 bits (93), Expect = 9e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +1 Query: 367 EVFSALMNRPTRGERRFAYW 426 +V +ALMNRPTRGERRFAYW Sbjct: 5 DVPAALMNRPTRGERRFAYW 24 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF ER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCRER 84 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +1 Query: 316 TTTIAFILCFRFRXEVWEVFSALMNRPTRGERRFAYW 426 TTT AF + R V V +ALMNRPTRGERRFAYW Sbjct: 43 TTTTAF----KSRKPV--VPAALMNRPTRGERRFAYW 73 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGER 121 >SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 116 AALMNRPTRGERRFAYW 132 >SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 73 AALMNRPTRGERRFAYW 89 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 121 AALMNRPTRGERRFAYW 137 >SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 120 AALMNRPTRGERRFAYW 136 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGER 196 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGER 121 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 244 AALMNRPTRGERRFAYW 260 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGER 320 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGER 158 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGER 145 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 140 AALMNRPTRGERRFAYW 156 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 94 AALMNRPTRGERRFAYW 110 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGER 170 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 58 AALMNRPTRGERRFAYW 74 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 154 AALMNRPTRGERRFAYW 170 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 51 AALMNRPTRGERRFAYW 67 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGER 127 >SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGER 157 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 199 AALMNRPTRGERRFAYW 215 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 251 ICDTGYIPLPRSLTRYARSFDCGER 275 >SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGER 117 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGER 116 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 341 AALMNRPTRGERRFAYW 357 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGER 417 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 196 AALMNRPTRGERRFAYW 212 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 248 ICDTGYIPLPRSLTRYARSFDCGER 272 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 96 AALMNRPTRGERRFAYW 112 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGER 172 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGER 158 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 559 AALMNRPTRGERRFAYW 575 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGER 635 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 271 AALMNRPTRGERRFAYW 287 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 315 AALMNRPTRGERRFAYW 331 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGER 391 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGER 121 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 158 AALMNRPTRGERRFAYW 174 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGER 234 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 116 AALMNRPTRGERRFAYW 132 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGER 192 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGER 156 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGER 118 >SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) Length = 99 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGER 157 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 476 AALMNRPTRGERRFAYW 492 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 73 AALMNRPTRGERRFAYW 89 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 36 AALMNRPTRGERRFAYW 52 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 127 AALMNRPTRGERRFAYW 143 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGER 203 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGER 126 >SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 85 AALMNRPTRGERRFAYW 101 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGER 161 >SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 5505 AALMNRPTRGERRFAYW 5521 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGER 177 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 188 AALMNRPTRGERRFAYW 204 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 11 AALMNRPTRGERRFAYW 27 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 63 ICDTGYIPLPRSLTRYARSFDCGER 87 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGER 137 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 548 AALMNRPTRGERRFAYW 564 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 600 ICDTGYIPLPRSLTRYARSFDCGER 624 >SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 162 AALMNRPTRGERRFAYW 178 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGER 137 >SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) Length = 711 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 648 AALMNRPTRGERRFAYW 664 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGER 195 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 169 AALMNRPTRGERRFAYW 185 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 44 AALMNRPTRGERRFAYW 60 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGER 120 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 65 AALMNRPTRGERRFAYW 81 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGER 141 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 87 AALMNRPTRGERRFAYW 103 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGER 163 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGER 140 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 94 AALMNRPTRGERRFAYW 110 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGER 129 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 54 AALMNRPTRGERRFAYW 70 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGER 156 >SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) Length = 490 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 357 AALMNRPTRGERRFAYW 373 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGER 154 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGER 123 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 185 AALMNRPTRGERRFAYW 201 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGER 261 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 576 AALMNRPTRGERRFAYW 592 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGER 652 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 298 AALMNRPTRGERRFAYW 314 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGER 374 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGER 121 >SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGER 147 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 802 AALMNRPTRGERRFAYW 818 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGER 878 >SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) Length = 917 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 581 AALMNRPTRGERRFAYW 597 >SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) Length = 709 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 137 AALMNRPTRGERRFAYW 153 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 187 AALMNRPTRGERRFAYW 203 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGER 263 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 86 AALMNRPTRGERRFAYW 102 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGER 162 >SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 216 AALMNRPTRGERRFAYW 232 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 487 AALMNRPTRGERRFAYW 503 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGER 563 >SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 32 AALMNRPTRGERRFAYW 48 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGER 108 >SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 145 AALMNRPTRGERRFAYW 161 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 932 AALMNRPTRGERRFAYW 948 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 984 ICDTGYIPLPRSLTRYARSFDCGER 1008 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 58 AALMNRPTRGERRFAYW 74 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGER 134 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGER 176 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 437 AALMNRPTRGERRFAYW 453 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGER 513 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGER 117 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 44 AALMNRPTRGERRFAYW 60 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGER 146 >SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 471 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 424 AALMNRPTRGERRFAYW 440 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 233 AALMNRPTRGERRFAYW 249 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGER 309 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 240 AALMNRPTRGERRFAYW 256 >SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) Length = 247 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 200 AALMNRPTRGERRFAYW 216 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 143 AALMNRPTRGERRFAYW 159 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 36 AALMNRPTRGERRFAYW 52 >SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 752 AALMNRPTRGERRFAYW 768 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGER 128 >SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) Length = 110 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 63 AALMNRPTRGERRFAYW 79 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +3 Query: 414 VCVLGALPXPRSLTRXARSFGXGER 488 +C G +P PRSLTR ARSF GER Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGER 98 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 376 SALMNRPTRGERRFAYW 426 +ALMNRPTRGERRFAYW Sbjct: 117 AALMNRPTRGERRFAYW 133 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,892,463 Number of Sequences: 59808 Number of extensions: 209807 Number of successful extensions: 1513 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1513 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2526446612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -