BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_F05 (866 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB17E12.13 |rpl1802|rpl18-2|60S ribosomal protein L18|Schizos... 128 1e-30 SPBC11C11.07 |rpl1801|rpl18-1, rpl18|60S ribosomal protein L18|S... 124 2e-29 >SPAPB17E12.13 |rpl1802|rpl18-2|60S ribosomal protein L18|Schizosaccharomyces pombe|chr 1|||Manual Length = 187 Score = 128 bits (308), Expect = 1e-30 Identities = 66/154 (42%), Positives = 94/154 (61%), Gaps = 2/154 (1%) Frame = +1 Query: 79 DINHKHDRKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRPPISV 258 DI H RK +R++ S+++ T+++FN+ +L+RLF S+ NRPPIS+ Sbjct: 4 DIERHHVRKSQRSKPASENVYLKLLVKLYRFLARRTDSRFNKAILKRLFQSKTNRPPISI 63 Query: 259 SRLAR--HMKKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKXXXXXXXXXXXXX 432 S++A K + EG V+VGTVT+D RL +PK++VAAL T+ Sbjct: 64 SKIAALTSRKSASLEGKTTVIVGTVTDDERLLTVPKLSVAALRFTKSARARILKAGGEVL 123 Query: 433 TFDQLALRAPTGKKTVLVQGQRNAREAVRHFGPG 534 T DQLALRAPTG TVL++G+++AREA RHFG G Sbjct: 124 TLDQLALRAPTGSNTVLLRGKKHAREAYRHFGFG 157 >SPBC11C11.07 |rpl1801|rpl18-1, rpl18|60S ribosomal protein L18|Schizosaccharomyces pombe|chr 2|||Manual Length = 187 Score = 124 bits (298), Expect = 2e-29 Identities = 63/154 (40%), Positives = 93/154 (60%), Gaps = 2/154 (1%) Frame = +1 Query: 79 DINHKHDRKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRPPISV 258 DI H +K +R++ S+++ T+++FN+ +L+RLF S+ NRPPIS+ Sbjct: 4 DIERHHVKKSQRSKPASENVYLKLLVKLYRFLARRTDSRFNKAILKRLFQSKTNRPPISI 63 Query: 259 SRLAR--HMKKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKXXXXXXXXXXXXX 432 S++A K + + VVVGTVT+D R+ +PK+++AAL T+ Sbjct: 64 SKIAALTSRKSASSQNKTTVVVGTVTDDERMLTVPKLSIAALRFTKSARARILKAGGEVL 123 Query: 433 TFDQLALRAPTGKKTVLVQGQRNAREAVRHFGPG 534 T DQLALRAPTG TVLV+G+++AREA RHFG G Sbjct: 124 TLDQLALRAPTGSNTVLVRGKKHAREAYRHFGFG 157 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,855,112 Number of Sequences: 5004 Number of extensions: 53459 Number of successful extensions: 140 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 432473040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -