BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_F04 (834 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC25D12.04 |suc22||ribonucleotide reductase small subunit Suc2... 27 4.3 SPBC646.03 |||glutamyl-tRNA amidotransferase|Schizosaccharomyces... 26 5.7 >SPBC25D12.04 |suc22||ribonucleotide reductase small subunit Suc22 |Schizosaccharomyces pombe|chr 2|||Manual Length = 391 Score = 26.6 bits (56), Expect = 4.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 150 NPSC*IRLISLATTTNYFEELIRSNQLNGLTXNVKQS 40 NP + ISLA TN+FE+ + Q+ G+ K++ Sbjct: 342 NPFDFMENISLAGKTNFFEKKVSDYQIAGVMSGTKRA 378 >SPBC646.03 |||glutamyl-tRNA amidotransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 471 Score = 26.2 bits (55), Expect = 5.7 Identities = 10/44 (22%), Positives = 26/44 (59%) Frame = +2 Query: 164 TNPHRLRRTSKSREIIQGNNYIVQYSWFCMGLYSSAILAVSVYS 295 T+P+ L + ++ +++ N Y+VQ + LY++++ + Y+ Sbjct: 261 THPNVLDKWNEFISLLKSNGYLVQEIQLPISLYANSVYSTMAYA 304 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,269,200 Number of Sequences: 5004 Number of extensions: 38630 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 410448950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -