BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_F04 (834 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51817| Best HMM Match : Avirulence (HMM E-Value=1.2) 30 2.7 >SB_51817| Best HMM Match : Avirulence (HMM E-Value=1.2) Length = 643 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 261 IVQQFSQSVYILGCRISACCHSYCSSMAKCTDAIL*TGRFLRTVMTNQQ 407 I QQ ++V L R A C Y + A CTD T R ++T+ Q+ Sbjct: 510 ITQQTVRTVQTLPNRQCALCRHYPTDSAHCTDITQQTVRIVKTLPNRQR 558 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,570,424 Number of Sequences: 59808 Number of extensions: 276450 Number of successful extensions: 535 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 535 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2347493764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -