BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_F04 (834 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043693-5|AAB97532.1| 105|Caenorhabditis elegans Hypothetical ... 45 8e-05 Z69302-6|CAL36504.1| 472|Caenorhabditis elegans Hypothetical pr... 30 2.3 >AF043693-5|AAB97532.1| 105|Caenorhabditis elegans Hypothetical protein C34B2.10 protein. Length = 105 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/47 (40%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = +3 Query: 162 IPTHIDYVGQAKAEKLYRAIITLFSIVGFVWGYIVQQFSQSVY-ILG 299 + +HID+ GQ AE+ Y+ I+T+ I+GF+ G+ QQ S +++ +LG Sbjct: 15 LSSHIDFQGQKVAERTYQVILTIAGIIGFLVGFWTQQLSYAMFTVLG 61 >Z69302-6|CAL36504.1| 472|Caenorhabditis elegans Hypothetical protein F40F8.11 protein. Length = 472 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 345 WPWRNSKNGSKQKSGTQEYTLTARIAELYNPIQNQL 238 +PW N+ Q SG + +A+ E YNP+ L Sbjct: 7 YPWNNNYYSHGQSSGNDSWAPSAQSQEQYNPVYPSL 42 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,552,265 Number of Sequences: 27780 Number of extensions: 217448 Number of successful extensions: 513 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2072006206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -