BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_F02 (853 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0253 - 16196275-16196307,16196425-16196550,16196643-161967... 29 6.2 02_01_0055 + 410661-411380,411481-413733,414486-414875,414983-41... 28 8.2 >10_08_0253 - 16196275-16196307,16196425-16196550,16196643-16196741, 16196822-16197001,16197090-16197371,16197471-16199141, 16199257-16199463,16199566-16199700,16199792-16200082, 16200403-16200621,16200876-16201034,16201120-16201181, 16201257-16201383,16201460-16201693,16201777-16202003, 16202163-16202257,16202341-16202468,16202574-16202594, 16202765-16202921,16203007-16203075,16203228-16203341, 16203415-16203491,16203576-16203688,16204432-16204507, 16204592-16204756,16204825-16204952,16205049-16205130, 16205426-16205548,16205633-16205860,16205933-16206034, 16206144-16206341,16206581-16206760,16206868-16207020, 16207690-16207797,16208201-16208355,16208786-16208912, 16209825-16209914,16209986-16210127,16210303-16210379, 16210467-16210582,16210638-16210773,16211130-16211198, 16211279-16211361,16211655-16211720,16211788-16211974, 16212054-16213547,16213635-16214165,16214234-16214363, 16214407-16215878,16216359-16216364,16216750-16217055, 16217364-16217468,16217577-16217772,16217862-16217929, 16218853-16220631,16221026-16221151,16221604-16221780, 16221997-16222128,16223461-16223498,16223710-16223788, 16224175-16224284,16224787-16224935,16225027-16225197, 16225281-16225552,16226355-16226442,16227942-16228369 Length = 5157 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/66 (21%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +2 Query: 374 HSHVMSHRSWQNSNLRL*XCILEKNCLRE-TLNSNGSFGMKTMRARCAATERMSGWFSTT 550 H+ ++S +W+N+N + C+ LR+ +L N G++ + + + + S Sbjct: 3920 HATLLSTNNWKNANQQYFKCLAMMQQLRQISLKFNKDLGLEEVNRATSFMDHLLSIMSEQ 3979 Query: 551 AHILYS 568 H Y+ Sbjct: 3980 RHFAYN 3985 >02_01_0055 + 410661-411380,411481-413733,414486-414875,414983-418153 Length = 2177 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 345 FDALYNADACTLTSCPTEAGKTQTLDF 425 F LYN D L + PT +GKT +F Sbjct: 1370 FTVLYNTDDSVLVAAPTGSGKTICAEF 1396 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,785,807 Number of Sequences: 37544 Number of extensions: 253946 Number of successful extensions: 518 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 518 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2373961368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -