BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_F01 (906 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23D3.14c |aah2||alpha-amylase homolog Aah2|Schizosaccharomyc... 26 6.4 SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual 26 8.5 >SPAC23D3.14c |aah2||alpha-amylase homolog Aah2|Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 26.2 bits (55), Expect = 6.4 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = -2 Query: 629 SPKGTFIGVINKLNYYYMIHYTL*VCTSEIFVFYLYIKQFVNAS*P 492 SPK TF +IN Y TL V + F LY + S P Sbjct: 454 SPKDTFFDIINNQKYVVNTDGTLKVVITNGFPIVLYPTSKIETSLP 499 >SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1828 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +3 Query: 120 LVEKSK*ILRESYFSCSLLFSRPHQRNLVNIFKEIERAVA 239 L E+ K L+ SC ++FS ++R+ V + +E+ ++ Sbjct: 1251 LRERLKINLQNVRLSCEIIFSNAYERSSVCVCREVNELIS 1290 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,191,648 Number of Sequences: 5004 Number of extensions: 39631 Number of successful extensions: 83 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 458501510 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -