BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_E23 (933 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17C9.07 |alg8||glucosyltransferase Alg8|Schizosaccharomyces ... 28 1.6 SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycos... 26 6.6 >SPAC17C9.07 |alg8||glucosyltransferase Alg8|Schizosaccharomyces pombe|chr 1|||Manual Length = 501 Score = 28.3 bits (60), Expect = 1.6 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +2 Query: 104 FLTTGFLFAACLTSVMSDKPTTKPICEQAFGNSGPCFAYIKLY 232 F GFLF L S++ KP + A ++ CF +I LY Sbjct: 152 FQYNGFLFGLLLWSIVLAKPEKNMLLSAAIFSALICFKHIFLY 194 >SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 26.2 bits (55), Expect = 6.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -2 Query: 434 PIYIFNSFYTKLHRFIHQLEKRACVNSKVSVT 339 P+ I NS TK+H+F+ L ++ ++VT Sbjct: 376 PVEISNSNVTKIHKFLDTLGRQVFTYEALNVT 407 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,521,610 Number of Sequences: 5004 Number of extensions: 25637 Number of successful extensions: 69 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 473333082 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -