BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_E19 (655 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43840| Best HMM Match : NDK (HMM E-Value=0) 55 6e-08 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 52 5e-07 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 47 1e-05 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 46 3e-05 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 42 3e-04 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 42 6e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 42 6e-04 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 42 6e-04 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 42 6e-04 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 40 0.001 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 40 0.002 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 39 0.003 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 39 0.003 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 39 0.003 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 39 0.004 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 39 0.004 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 38 0.005 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 38 0.007 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 38 0.009 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 38 0.009 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 37 0.012 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 37 0.016 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 37 0.016 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 36 0.022 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 36 0.029 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 36 0.029 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 36 0.029 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 36 0.029 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 35 0.050 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 35 0.050 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 35 0.050 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.067 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 35 0.067 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 35 0.067 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.067 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.067 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.088 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.088 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 34 0.088 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 34 0.088 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.088 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 34 0.12 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 33 0.20 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 33 0.20 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 33 0.20 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 33 0.20 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 33 0.20 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 33 0.27 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 33 0.27 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 33 0.27 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.35 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 32 0.35 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.35 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 32 0.35 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.35 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 0.37 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 32 0.47 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 32 0.47 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 32 0.47 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 31 0.62 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 0.82 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 0.82 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 31 1.1 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 31 1.1 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 31 1.1 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.1 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 30 1.4 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 30 1.9 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 30 1.9 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 30 1.9 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 29 2.5 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 2.5 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 29 2.5 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 29 2.5 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 29 2.5 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 29 2.5 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 29 2.5 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 29 2.5 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 29 3.3 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) 29 4.4 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 29 4.4 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 29 4.4 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 29 4.4 SB_15859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_19554| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 28 5.8 SB_9261| Best HMM Match : Chitin_synth_2 (HMM E-Value=2.7e-07) 28 5.8 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 28 7.6 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 28 7.6 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 28 7.6 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 28 7.6 >SB_43840| Best HMM Match : NDK (HMM E-Value=0) Length = 786 Score = 54.8 bits (126), Expect = 6e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 157 FIMVKPDGVXRGLVGXIIERFEKKGFKLV 243 FIMVKPDGV RGLVG II+RFE+KGFKLV Sbjct: 130 FIMVKPDGVQRGLVGEIIKRFEQKGFKLV 158 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +1 Query: 124 FMMSRNXVSVLFIMVKPDGVXRGLVGXIIERFEKKGFKLV 243 + MS N + F+M+KPD V RGL+G II RFEKKGFKLV Sbjct: 633 YKMSNNERT--FLMIKPDAVSRGLIGEIISRFEKKGFKLV 670 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 54.4 bits (125), Expect = 8e-08 Identities = 31/104 (29%), Positives = 32/104 (30%), Gaps = 1/104 (0%) Frame = +3 Query: 339 PPXVXXXNXXPXFXXXPPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAP 518 PP P + P P PPP P PP P P Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPP 155 Query: 519 XXPPXXGAPP-PPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 PP PP PP P PPPP P PP P P P P Sbjct: 156 YPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 51.6 bits (118), Expect = 5e-07 Identities = 32/102 (31%), Positives = 35/102 (34%), Gaps = 3/102 (2%) Frame = +3 Query: 324 PXAFFPPXVXXXNXXPXFXXXPPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXX 503 P A +PP P PPP PPP P+ PPPP + Sbjct: 136 PNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPP-YPPPPNPPYPPPPNPP 194 Query: 504 XXXAPXXP--PXXGAPPPPXPXXXXPP-PPXPXXSXPPXPXP 620 P P P P PP P PP PP P PP P P Sbjct: 195 YPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 49.2 bits (112), Expect = 3e-06 Identities = 30/104 (28%), Positives = 31/104 (29%), Gaps = 1/104 (0%) Frame = +3 Query: 339 PPXVXXXNXXPXFXXXP-PPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXA 515 PP P + P P PPP P P PP Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPP 163 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP AP PP P P PP P PP P P P P Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 47.2 bits (107), Expect = 1e-05 Identities = 29/80 (36%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +3 Query: 390 PPXXPPPXXWXXPSFXXP-PPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPP-PPXPX 563 PP PPP PS P PPP AP PP PP PP P Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPP 189 Query: 564 XXXPP-PPXPXXSXPPXPXP 620 PP PP P PP P P Sbjct: 190 PPNPPYPPPPNAPNPPPPNP 209 Score = 44.4 bits (100), Expect = 8e-05 Identities = 33/131 (25%), Positives = 35/131 (26%), Gaps = 4/131 (3%) Frame = +3 Query: 267 PIXKXPXXPXXXXXXXFGXPXAFFPPXVXXXNXXPXFXXXPPPXXPPPXXWXXPSFXXPP 446 P P P P +PP P PPP P + PP Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP 152 Query: 447 -PPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXXXXPPP---PXPXXSXPPXP 614 PP P PP P PP P PPP P P PP P Sbjct: 153 NPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYP 212 Query: 615 XPXXXXXXPXP 647 P P P Sbjct: 213 PPPNAPNPPYP 223 Score = 44.4 bits (100), Expect = 8e-05 Identities = 26/89 (29%), Positives = 29/89 (32%) Frame = +3 Query: 324 PXAFFPPXVXXXNXXPXFXXXPPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXX 503 P +PP N P PPP PPP P + PP P + Sbjct: 157 PPPLYPPP---PNPPPPNAPYPPPPYPPPPN---PPYPPPPNPPYPPPPNAPNPPPPNPP 210 Query: 504 XXXAPXXPPXXGAPPPPXPXXXXPPPPXP 590 P P PPP P PPPP P Sbjct: 211 YPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/111 (25%), Positives = 29/111 (26%) Frame = +2 Query: 323 PXRXFSPXGXQXKXXPXLFXXPXPXXPPPXXLXXPXFXXPAPPXFSXXXXXXXXXXXXXX 502 P FSP + P P PPP P P PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPP-PNPPYPPPPNAPYPP 142 Query: 503 XXXGPXPXPXXGRXPPTPXPXPXXPPPXPXXLXPXTXXXXPXXXXPXPXKP 655 P P P PP P P PPP P P P P P Sbjct: 143 SPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNP 193 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 528 PXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PPPP P PPPP P PP P P P P Sbjct: 90 PNPPYPPPPYP-PYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 35.1 bits (77), Expect = 0.050 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXX-XPPPPXLXPPXXHXXXXPXPXXXXPP 648 PP P PP+P P PPPP PP P P PP Sbjct: 154 PPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 34.7 bits (76), Expect = 0.067 Identities = 25/93 (26%), Positives = 26/93 (27%), Gaps = 5/93 (5%) Frame = +2 Query: 392 PXXPPPXXLXXPXFXXPAPPX-FSXXXXXXXXXXXXXXXXXGPXPXPXXGRXPPTPXPXP 568 P PPP P P PP + P P P PP P P P Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPP 182 Query: 569 XXPP----PXPXXLXPXTXXXXPXXXXPXPXKP 655 PP P P P P P P P Sbjct: 183 PNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +1 Query: 508 GXPPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 G PP PP+P P PPP PP + P P PP Sbjct: 82 GHPPTN--FSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPP 126 Score = 32.3 bits (70), Expect = 0.35 Identities = 24/90 (26%), Positives = 24/90 (26%) Frame = +2 Query: 386 PXPXXPPPXXLXXPXFXXPAPPXFSXXXXXXXXXXXXXXXXXGPXPXPXXGRXPPTPXPX 565 P P PPP P P P P P P PP P P Sbjct: 112 PNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYP-PPPNP-PP 169 Query: 566 PXXPPPXPXXLXPXTXXXXPXXXXPXPXKP 655 P P P P P P P P P Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 31.1 bits (67), Expect = 0.82 Identities = 26/121 (21%), Positives = 31/121 (25%), Gaps = 2/121 (1%) Frame = +1 Query: 292 PXXPXXXXLAPPXXFFPPGXTXKTXPXXFXXXXPXXXPPXXFGXXXLFXXRPPXFFXXXX 471 P P PP +PP P P PP + P + Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP 152 Query: 472 XXXXXXXXXXXXGXPPXXPXXGAXPPHPXPXXXX--PPPPXLXPPXXHXXXXPXPXXXXP 645 PP PP+P P PPP PP + P P P Sbjct: 153 NPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYP 212 Query: 646 P 648 P Sbjct: 213 P 213 Score = 31.1 bits (67), Expect = 0.82 Identities = 27/119 (22%), Positives = 29/119 (24%) Frame = +1 Query: 292 PXXPXXXXLAPPXXFFPPGXTXKTXPXXFXXXXPXXXPPXXFGXXXLFXXRPPXFFXXXX 471 P P PP +PP P P PP PP + Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPY----- 179 Query: 472 XXXXXXXXXXXXGXPPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 PP P A P P PPP PP P P PP Sbjct: 180 -PPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 30.3 bits (65), Expect = 1.4 Identities = 22/89 (24%), Positives = 22/89 (24%), Gaps = 1/89 (1%) Frame = +2 Query: 392 PXXPPPXXLXXPXFXXPAP-PXFSXXXXXXXXXXXXXXXXXGPXPXPXXGRXPPTPXPXP 568 P PPP P P P P P P P P P P P Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Query: 569 XXPPPXPXXLXPXTXXXXPXXXXPXPXKP 655 PP P P P P P Sbjct: 207 PNPPYPPPPNAPNPPYPPPPNAPNPPYPP 235 Score = 28.7 bits (61), Expect = 4.4 Identities = 26/119 (21%), Positives = 27/119 (22%) Frame = +2 Query: 290 PPXXXXXXXWXPXRXFSPXGXQXKXXPXLFXXPXPXXPPPXXLXXPXFXXPAPPXFSXXX 469 PP P + P P P P PPP P P PP Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPY----P 180 Query: 470 XXXXXXXXXXXXXXGPXPXPXXGRXPPTPXPXPXXPPPXPXXLXPXTXXXXPXXXXPXP 646 P P PP P P P P P P P P Sbjct: 181 PPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/51 (31%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +3 Query: 324 PXAFFPPXVXXXNXXPXFXXXPPPXX------PPPXXWXXPSFXXPPPPXF 458 P +PP N P PPP PPP P + PP P F Sbjct: 191 PNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNPQF 241 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 51.6 bits (118), Expect = 5e-07 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 PPP PPP P PPPP P PP PPPP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPP------------PSPPPPPQPPPPPPPPPPPPPPPPPP 412 Query: 567 XXPPPPXPXXSXPPXPXP 620 PPPP P PP P P Sbjct: 413 PPPPPPAPPPPPPPPPPP 430 Score = 48.0 bits (109), Expect = 7e-06 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP PPPP P PPPP P PP P P P P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP PPPP P PPPP P PP P P P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 46.0 bits (104), Expect = 3e-05 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 PPP PPP P PP P P PP APPPP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 567 XXPPPPXPXXSXPP 608 PPP PP Sbjct: 428 PPPPPALRLACAPP 441 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 +P PP PPPP P PPPP P S PP P P P P Sbjct: 364 SPPPPP----PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP +PPPP P PPP P PP P P P P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP PPPP P PPPP PP P P P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP +PPPP PPPP P PP P P P P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP PPPP P PPP P PP P P P P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP PPPP P PPP P PP P P P P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 PP PPPP PPPP P PP P P P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP P PP P PP P P PP P P P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP PP P P PPP P PP P P P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P P PPPP P PP P P PP P P P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 PP P PP P P PPPP PP P P PP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 35.9 bits (79), Expect = 0.029 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 515 PXPXPXXGRXPPTPXPXPXXPPPXPXXLXPXTXXXXPXXXXPXPXKP 655 P P P PP+P P P PPP P P P P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPP-PPQPPPPPPPPPPPPPPPP 410 Score = 35.9 bits (79), Expect = 0.029 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 515 PXPXPXXGRXPPTPXPXPXXPPPXPXXLXPXTXXXXPXXXXPXPXKP 655 P P P PP+P P P PPP P P P P P P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPP-PPPPPPPPPPPPPPPPAPP 421 Score = 35.5 bits (78), Expect = 0.038 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 PP P PP P P PPP PP P P PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 35.5 bits (78), Expect = 0.038 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 PP P PP P P PPP PP P P PP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 35.5 bits (78), Expect = 0.038 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 PP P P P P PPPP PP P P PP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 35.1 bits (77), Expect = 0.050 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 515 PXPXPXXGRXPPTPXPXPXXPPPXPXXLXPXTXXXXPXXXXPXPXKP 655 P P P PP P P PPP P P P P P P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 33.9 bits (74), Expect = 0.12 Identities = 21/73 (28%), Positives = 22/73 (30%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 PPP PPP P PPPP P PP PPPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP--PPPPPALR 435 Query: 567 XXPPPPXPXXSXP 605 PP + P Sbjct: 436 LACAPPRLRFTSP 448 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXP 624 PP P PP P PPPP PP P Sbjct: 404 PPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAP 440 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 49.6 bits (113), Expect = 2e-06 Identities = 25/76 (32%), Positives = 25/76 (32%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 P P P P P PPPP P PP A PPP P Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPAT 965 Query: 567 XXPPPPXPXXSXPPXP 614 PPPP P PP P Sbjct: 966 QVPPPPLPPLPPPPPP 981 Score = 34.7 bits (76), Expect = 0.067 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 516 PXXP-PXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 P P P APPPP P PPPP P PP P Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLP---PPPPP 928 Score = 32.3 bits (70), Expect = 0.35 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXPXP 620 P P P PPPP P PP P P Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLP 923 Score = 31.1 bits (67), Expect = 0.82 Identities = 24/91 (26%), Positives = 24/91 (26%) Frame = +3 Query: 369 PXFXXXPPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPP 548 P P P P P P PPPP P P Sbjct: 895 PTTPTTPKPTTPAPPP-PLPLAPEPPPPL---PPPPPPIQTTRPTVPTTPTTQASTTRPT 950 Query: 549 PPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 PP P PPP P PP P P P Sbjct: 951 PPPPTSAL-PPPIPATQVPPPPLPPLPPPPP 980 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 PPPP P PP PP P P P Sbjct: 1114 PPPPPPPTEIPPAQETFEGSPPCPSPCSVICLP 1146 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 49.2 bits (112), Expect = 3e-06 Identities = 28/78 (35%), Positives = 29/78 (37%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 PPP PP P+ PPPP P PP G PPPP P Sbjct: 348 PPPTNNPPSP-PPPTNNTPPPP--------------PPTNKPPPPPPPTNGPPPPPPPTN 392 Query: 567 XXPPPPXPXXSXPPXPXP 620 PPPP P PP P P Sbjct: 393 GPPPPPPPTNGPPPPPPP 410 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP PPPP P PPPP P + PP P P P P Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP PPPP P PPPP P PP P P P P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 46.8 bits (106), Expect = 2e-05 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 PP PPPP P PPPP P PP P P P P Sbjct: 359 PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP P PP P PPPP P PP P P P P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP PPP P PPPP P + PP P P P P Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 537 GAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 G PPP P P PP P + PP P P P P Sbjct: 343 GVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPP 379 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 537 GAPPPPXPXXXXPPPPXPXXSXPPXP 614 GAP P P PPPP P S PP P Sbjct: 70 GAPSTPAP----PPPPPPPSSGPPLP 91 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 508 GXPPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 G P P P P P PPPP PP P P PP Sbjct: 343 GVNPPPPPTNNPPSPPPPTNNTPPPP---PPTNKPPPPPPPTNGPPP 386 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 521 PXPXXGRXPPTPXPXPXXPPPXPXXLXPXTXXXXPXXXXPXPXKP 655 P P PP P P PPP P P P P P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +2 Query: 512 GPXPXPXXGRXPPTPXPXPXXPPPXPXXLXPXTXXXXPXXXXPXPXKP 655 G P P PP+P P PP P P P P P Sbjct: 343 GVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/49 (30%), Positives = 16/49 (32%), Gaps = 5/49 (10%) Frame = +1 Query: 517 PXXPXXGAXPPHPXPXXXXPPPPXL-----XPPXXHXXXXPXPXXXXPP 648 P P PP P PPPP PP + P P PP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 405 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/76 (32%), Positives = 27/76 (35%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 P PPP P+ PPPP P PP G PPPP P Sbjct: 146 PATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPP--PPSGGPPPPPPPPP 203 Query: 567 XXPPPPXPXXSXPPXP 614 PPPP + PP P Sbjct: 204 PPPPPPILELAAPPPP 219 Score = 38.3 bits (85), Expect = 0.005 Identities = 27/90 (30%), Positives = 29/90 (32%), Gaps = 3/90 (3%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXX---APXXPPXXGAPPPPX 557 P PPP P+ PPPP AP P +PPPP Sbjct: 133 PATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPS 192 Query: 558 PXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 PPPP P PP P P P P Sbjct: 193 ---GGPPPP-PPPPPPPPPPPILELAAPPP 218 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPP-XPXXSXPPXPXP 620 AP PP AP P PPPP P PP P P Sbjct: 107 APTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPP 143 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = +3 Query: 513 APXXPPXXGAPPPPX--PXXXXPPPP---XPXXSXPPXPXP 620 AP P +PPPP P PPPP P PP P P Sbjct: 116 APETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPP 156 Score = 31.9 bits (69), Expect = 0.47 Identities = 24/87 (27%), Positives = 26/87 (29%), Gaps = 2/87 (2%) Frame = +3 Query: 393 PXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPP--XPXX 566 P PPP P+ PPPP P P G PPPP P Sbjct: 124 PSPPPPPT--SPATRAPPPP-------PPIAPATGGPPPPPPIAPATGGPPPPPPIAPAA 174 Query: 567 XXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P P P + P P P P Sbjct: 175 TVPAPAVPLAAASPPPPSGGPPPPPPP 201 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 517 PXXPXXGAXPPHPX---PXXXXPPPPXLXPPXXHXXXXPXP 630 P P A PP P P PPPP PP P P Sbjct: 179 PAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 29.1 bits (62), Expect = 3.3 Identities = 23/94 (24%), Positives = 23/94 (24%), Gaps = 4/94 (4%) Frame = +2 Query: 386 PXPXXPPPXXLXXPXFXXPAPPXFSXXXXXXXXXXXXXXXXXGPXPXPXX----GRXPPT 553 P P PP P PP S GP P P G PP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Query: 554 PXPXPXXPPPXPXXLXPXTXXXXPXXXXPXPXKP 655 P P P P P P P P Sbjct: 168 PPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPP 201 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 46.0 bits (104), Expect = 3e-05 Identities = 30/87 (34%), Positives = 30/87 (34%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXX 467 G G G G GG G GGGG G GGGG GG G Sbjct: 791 GGGGGGGGGGGGDGGGYGDGDGGGG---GGGGGGGGGGDGGGYGDGGGFGDGGGYADGDG 847 Query: 466 XXXKXGGGGXXKXGXXQXXGGGXXGGG 386 GGGG G GGG GGG Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWG-GXAPXXGXXGGXPXXXXGGGGGG 477 GG G G + GG GGGG G G G G G GG GGGGGG Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGG 853 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/57 (36%), Positives = 22/57 (38%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G G + GG GGG G GG G GG GGGGGG Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -3 Query: 629 GXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G G GG GGGG G G GG G G GGGGGG Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG 822 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/57 (38%), Positives = 23/57 (40%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G G + GG GGG G G GG G GG GGGGGG Sbjct: 819 GGGGGGGDGGGYG-DGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 37.5 bits (83), Expect = 0.009 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWG-GXAPXXGXXGGXPXXXXGGGGGG 477 GG G G GG G GG G G+G G G GG GGGGGG Sbjct: 804 GGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGG 861 Score = 37.1 bits (82), Expect = 0.012 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G G GG GGGG G G GG G GG GGG GG Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDG-GGYGDGDGGGGGGGGGGGGGGDGG 828 Score = 36.7 bits (81), Expect = 0.016 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -3 Query: 653 VXGGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 V GG G GG GGGG G G G GG GGGGGG Sbjct: 767 VVGGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 35.1 bits (77), Expect = 0.050 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 G G GG G GGGG G GGGG GG Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 33.9 bits (74), Expect = 0.12 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G G GG GGG G G GG G GG G GGG Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 33.1 bits (72), Expect = 0.20 Identities = 27/98 (27%), Positives = 28/98 (28%) Frame = -3 Query: 584 GGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGGVWVXXXKXXGGRXXKRXXXPXXXG 405 GGGG G GG G GG GGG GG + GG G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGY-GDGDGGGGGGGGGGGGGGDGG 828 Query: 404 GXXXGXXXXKXXGXVXXVXPGGKKXXGGAKXXXXGXXG 291 G G G GG GG G G Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGG 866 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 652 FXGXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGG 542 F G G G GG G GGGG G GGGG Sbjct: 836 FGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 31.9 bits (69), Expect = 0.47 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXG 527 G G G GG G GGGG G GGGG G Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G G GG G GG G G GG G GG GGG G Sbjct: 782 GGDGGGGGGGGGGGGGGGGG-GDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFG 837 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 42.3 bits (95), Expect = 3e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 PP PPPP P PPPP P PP P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 540 APPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 APPPP P PPPP P PP P P P Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 36.3 bits (80), Expect = 0.022 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 537 GAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 G PPP P PPPP P PP P P P P Sbjct: 461 GQAPPPPPP-PPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 515 PXPXPXXGRXPPTPXPXPXXPPPXPXXLXPXT 610 P P P PP P P P PPP P L T Sbjct: 472 PPPPPPPPPPPPPPPPFPPPPPPTPLHLAAIT 503 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 508 GXPPXXPXXGAXPPHPXPXXXXPPPPXLXPP 600 G P P PP P P PPPP PP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 515 PXPXPXXGRXPPTPXPXPXXPPPXPXXL 598 P P P PP P P P PPP P L Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPPPPPTPL 497 Score = 32.3 bits (70), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPP 452 PPP PPP P F PPPP Sbjct: 473 PPPPPPPPPPPPPPPFPPPPPP 494 Score = 31.5 bits (68), Expect = 0.62 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 512 GPXPXPXXGRXPPTPXPXPXXPPPXPXXLXP 604 G P P PP P P P PPP P P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXF 458 PPP PPP P PPPP F Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPF 488 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 515 PXPXPXXGRXPPTPXPXPXXPPPXPXXLXPXTXXXXP 625 P P P PP P P P PPP P P P Sbjct: 464 PPPPPP----PPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPP 452 PPP PPP P PPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPP 485 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPP 452 PPP PPP P PPPP Sbjct: 471 PPPPPPPPPPPPPPPPPFPPPP 492 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPP 452 PPP PPP P PPPP Sbjct: 472 PPPPPPPPPPPPPPPPFPPPPP 493 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 559 PXXXXPPPPXLXPPXXHXXXXPXPXXXXPPQT 654 P PPPP PP P P PP T Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPT 495 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 41.5 bits (93), Expect = 6e-04 Identities = 23/76 (30%), Positives = 24/76 (31%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 PPP PPP + PPPP PP PPPP P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPP---PPPPPPGC 750 Query: 567 XXPPPPXPXXSXPPXP 614 PPP P P P Sbjct: 751 AGLPPPPPPIDVPMKP 766 Score = 34.3 bits (75), Expect = 0.088 Identities = 24/86 (27%), Positives = 24/86 (27%) Frame = +3 Query: 390 PPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXXX 569 PP PP S PPPP P PP PPP P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPP---PPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP--- 730 Query: 570 XPPPPXPXXSXPPXPXPXXXXXXPXP 647 P P PP P P P P Sbjct: 731 SPQPGCAGLPPPPPPPPPGCAGLPPP 756 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 1/45 (2%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXX-XPPPPXLXPPXXHXXXXPXPXXXXP 645 PP PP P P PPPP PP P P P Sbjct: 719 PPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 41.5 bits (93), Expect = 6e-04 Identities = 31/105 (29%), Positives = 32/105 (30%), Gaps = 4/105 (3%) Frame = +3 Query: 339 PPXVXXXNXXPXFXXXPPPXX----PPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXX 506 PP P PPP PPP + PPPP Sbjct: 290 PPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPS-------RSSQRPPPPS 342 Query: 507 XXAPXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 AP PP G PPP PPPP P PP P P P Sbjct: 343 RGAPP-PPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPP 386 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP GA PPP P PPPP S PP P P P Sbjct: 287 PPPPPSRGAAPPP-PSRGAPPPPPSRGSAPPPPPARMGTAPPPP 329 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 AP P PPPP PPPP + PP P P P P Sbjct: 296 APPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPP 340 Score = 39.9 bits (89), Expect = 0.002 Identities = 26/87 (29%), Positives = 27/87 (31%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 PPP PS PPPP P PP G PPPP P Sbjct: 328 PPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPP-----PPPPPVGGPPPPPPPIE 382 Query: 567 XXPPPPXPXXSXPPXPXPXXXXXXPXP 647 PP + PP P P P P Sbjct: 383 GR--PPSSLGNPPPPPPPGRGAPPPGP 407 Score = 35.1 bits (77), Expect = 0.050 Identities = 26/90 (28%), Positives = 28/90 (31%), Gaps = 3/90 (3%) Frame = +3 Query: 387 PPPXX---PPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPX 557 PPP PPP PS PPPP P PP + PP Sbjct: 289 PPPSRGAAPPP-----PSRGAPPPPP---SRGSAPPPPPARMGTAPPPPPPSRSSQRPPP 340 Query: 558 PXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PPPP + PP P P Sbjct: 341 PSRGAPPPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 32.3 bits (70), Expect = 0.35 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +1 Query: 508 GXPPXXPXXGAXPPHPXPXXX--XPPPPXLXPPXXHXXXXPXPXXXXPP 648 G PP P G+ PP P P PPPP PP P P PP Sbjct: 303 GAPPPPPSRGSAPP-PPPARMGTAPPPP---PPSRSSQRPPPPSRGAPP 347 Score = 32.3 bits (70), Expect = 0.35 Identities = 23/89 (25%), Positives = 24/89 (26%), Gaps = 4/89 (4%) Frame = +2 Query: 401 PPPXXLXXPXFXXPAPPXFSXXXXXXXXXXXXXXXXXGPXPXPXXGRXPPTPXP----XP 568 PPP P PP S G P P G PP P P P Sbjct: 315 PPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGP 374 Query: 569 XXPPPXPXXLXPXTXXXXPXXXXPXPXKP 655 PPP P + P P P Sbjct: 375 PPPPPPIEGRPPSSLGNPPPPPPPGRGAP 403 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 517 PXXPXXGAXPPH-----PXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPPQT 654 P P GA PP P P PPP PP P P PP + Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSS 388 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 537 GAPPPPXPXXXXPPPPXPXXSXPPXP 614 G PPP P PPP + PP P Sbjct: 284 GIQPPPPPSRGAAPPPPSRGAPPPPP 309 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 P PP GAPPPP P PPPP PP P P Sbjct: 305 PPPPPPGGAPPPPPP---PPPPPPGDGGAPPPPPP 336 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 AP PP G PPP P PPPP + PP P P Sbjct: 303 APPPPPPPGGAPPP-PPPPPPPPPGDGGAPPPPPPP 337 Score = 37.5 bits (83), Expect = 0.009 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +3 Query: 516 PXXPPXXG---APPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP G APPPP P PPPP P P P P P P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPP-----PPPPPPGDGGAPPP 333 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/67 (32%), Positives = 23/67 (34%) Frame = +3 Query: 390 PPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXXX 569 P PPP P+ PPPP AP PP PPPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPP------------------GGAPPPPPPP-PPPPPGDGGA 330 Query: 570 XPPPPXP 590 PPPP P Sbjct: 331 PPPPPPP 337 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 41.5 bits (93), Expect = 6e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 PPPP P PPPP P PP P P P P Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 38.3 bits (85), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 P PP PPPP P P PP P PP P Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP PPP P P PP P PP P P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEP 248 Score = 34.7 bits (76), Expect = 0.067 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 515 PXPXPXXGRXPPTPXPXPXXPPPXPXXLXPXTXXXXPXXXXPXPXKP 655 P P P PP P P P PPP P P P P P Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMP 255 Score = 34.7 bits (76), Expect = 0.067 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPP-PPXPXXSXPPXPXP 620 +P PP +P PP P PP PP P + P P P Sbjct: 214 SPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP P PP P PP P P P P P P Sbjct: 218 PPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 517 PXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPPQ 651 P P PP P P PPP PP P P PP+ Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPR 239 Score = 31.9 bits (69), Expect = 0.47 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +3 Query: 402 PPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXXXXPPP 581 PPP PS PPPP +P PP P PP P P Sbjct: 205 PPPPPRPPPSPPPPPPPP-----------------SPSPPRPPPPPPPSPPRPLAAKLPE 247 Query: 582 PXPXXSXPPXPXPXXXXXXP 641 P P + PP P P Sbjct: 248 PPPIPNMPPTLPPPTLGYLP 267 Score = 31.5 bits (68), Expect = 0.62 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 PP P PP P P PPPP P P P PP Sbjct: 216 PPPPPPPSPSPPRPPP----PPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPP 452 PPP PPP PS PPPP Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPP 232 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = +2 Query: 545 PPTPXPXPXXPPPXPXXLXPXTXXXXPXXXXPXPXKP 655 PP P P P PP P + P P P +P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 41.1 bits (92), Expect = 8e-04 Identities = 28/85 (32%), Positives = 28/85 (32%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 PPP PPP P PPPP AP PP G PP Sbjct: 920 PPP--PPPPGGNAP---LPPPPP-----GGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGG 969 Query: 567 XXPPPPXPXXSXPPXPXPXXXXXXP 641 P PP P S PP P P P Sbjct: 970 APPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 513 APXXPPXXG--APPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 AP PP G APPPP P PP P PP P P P P Sbjct: 941 APSQPPPPGGNAPPPPPPPGGSAPP--PGGGAPPLPPPPGGSAPPPP 985 Score = 37.5 bits (83), Expect = 0.009 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +3 Query: 513 APXXPPXXGA--PPPPXPXXXXP-PPPXPXXSXPPXPXPXXXXXXPXP 647 +P P G+ PPPP P P PPP P S P P P P P Sbjct: 909 SPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPP 956 Score = 35.9 bits (79), Expect = 0.029 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +3 Query: 516 PXXPPXXGAPP-PPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP AP PP P PPPP P P P P P Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 34.7 bits (76), Expect = 0.067 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +1 Query: 517 PXXPXXGAXPPHPXPXXXXPPP----PXLXPPXXHXXXXPXPXXXXPP 648 P P A PP P P PPP P L PP P P PP Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 P P G+ PP P P P P P P P PP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPP 954 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 508 GXPPXXPXXGAXPPHPXPXXXXPPPPXL 591 G PP P G P P P PPPP + Sbjct: 969 GAPPLPPPPGGSAP-PPPPPPPPPPPPM 995 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXPXP 620 PPPP P PPPP P S PP P P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 37.1 bits (82), Expect = 0.012 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 528 PXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 P PPPP P PPPP P PP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPP 608 P PP PPPP P PPPP P S PP Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPPP--STPP 715 Score = 35.9 bits (79), Expect = 0.029 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 PPPP P PPPP P P P P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 515 PXPXPXXGRXPPTPXPXPXXPPPXPXXLXPXTXXXXP 625 P P P PP P P P PPP P P P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 31.5 bits (68), Expect = 0.62 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 546 PPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P P PPPP P PP P P P P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 31.1 bits (67), Expect = 0.82 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 526 PXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 P PP P P PPPP PP P P PP Sbjct: 677 PIQTMVPPPPPPPPPPPPPP--PPPPPQPSTPPPPPPSTPP 715 Score = 31.1 bits (67), Expect = 0.82 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPP 452 PPP PPP PS PPPP Sbjct: 690 PPPPPPPPPPPPQPSTPPPPPP 711 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P P PPPP P PP P P P P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 521 PXPXXGRXPPTPXPXPXXPPPXP 589 P P PP P P P PPP P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPP 697 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 547 PHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPPQ 651 P P P PPPP PP P P P Q Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQ 717 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPP 452 PPP PPP P PPPP Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPP 709 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/57 (36%), Positives = 23/57 (40%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G G + GG GGGG G G+ G G GG G GGGG Sbjct: 129 GGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGG 185 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/62 (35%), Positives = 23/62 (37%) Frame = -3 Query: 629 GXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGGVWVXXXKXX 450 G G GG GGGG G G GG G GG GG GGG + Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGG 226 Query: 449 GG 444 GG Sbjct: 227 GG 228 Score = 36.7 bits (81), Expect = 0.016 Identities = 22/57 (38%), Positives = 23/57 (40%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G G GG GGGG G G+GG G GG GGG GG Sbjct: 151 GGGYRGGGGGYRGRGRGGGGYGGGGYG--GGGYGGGGHGGGGYGGGGYGGGGGGYGG 205 Score = 36.3 bits (80), Expect = 0.022 Identities = 30/89 (33%), Positives = 31/89 (34%) Frame = -1 Query: 652 FXGXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXX 473 + G G G G GG G GGGG G GGGG GG G Sbjct: 154 YRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGG--YGGGGYGGGGGGYGGSG---- 207 Query: 472 XXXXXKXGGGGXXKXGXXQXXGGGXXGGG 386 GGGG G GGG GGG Sbjct: 208 ------YGGGGGYGGG---GYGGGRSGGG 227 Score = 35.1 bits (77), Expect = 0.050 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -3 Query: 644 GXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G G G GG GGGG G G GG GG GG GGG Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 Score = 34.7 bits (76), Expect = 0.067 Identities = 21/57 (36%), Positives = 22/57 (38%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G G + G GGGG G G GG GG GGGGGG Sbjct: 150 GGGGYRGGGGGYR----GRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGG 202 Score = 33.9 bits (74), Expect = 0.12 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = -3 Query: 629 GXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G G GG R GGGG G G+ G G GG GGGG G Sbjct: 123 GGGGRRGGGYGGGR-GGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYG 172 Score = 33.9 bits (74), Expect = 0.12 Identities = 22/58 (37%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGG-GGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G G + GG R G GG G G+GG G GG G GGGG Sbjct: 145 GGGYRGGGG--YRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGG 200 Score = 33.9 bits (74), Expect = 0.12 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = -3 Query: 644 GXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGG--GGG 477 G G G GG GGGG G G+GG G GG GGG GGG Sbjct: 172 GGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSG--YGGGGGYGGGGYGGGRSGGG 227 Score = 33.9 bits (74), Expect = 0.12 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 644 GXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGG 483 G G G GG GGGG G G+GG G GG GGGG Sbjct: 177 GGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGG--GGYGGGRSGGGG 228 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 G G G G GG G GGGG G GGG GG Sbjct: 188 GGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 31.9 bits (69), Expect = 0.47 Identities = 29/108 (26%), Positives = 30/108 (27%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXX 467 G G G G GG GGG G GGG GG G Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGG----GGYRGRGRGGGGYGGGGYGGG 179 Query: 466 XXXKXGGGGXXKXGXXQXXGGGXXGGGXXKKXGXXFXLXTXGGKXAXG 323 G GG G GGG GG G GG+ G Sbjct: 180 GYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 Score = 31.1 bits (67), Expect = 0.82 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGGVWV 468 GG G G GG GGG G GG G G GG GGG + Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 Query: 467 XXXKXXGG 444 GG Sbjct: 183 GGGHGGGG 190 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGA 512 G G G GCGG G GGGG G GGGGA GG GA Sbjct: 48 GAGNGVGAGGCGCGGGNDGGNGGGG-AGNGGGGGGA-GNGGAAGA 90 Score = 33.1 bits (72), Expect = 0.20 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXG----GXPXXXXGGGGG 480 GG G G GG G GG G GG A G G G GGG G Sbjct: 46 GGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSG 105 Query: 479 GV 474 GV Sbjct: 106 GV 107 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGG 480 GG GGGG G G G A G GG GGG G Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAG 74 Score = 31.9 bits (69), Expect = 0.47 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 596 GXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G G GG G G GG G GG G GGGG Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGG 79 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/76 (31%), Positives = 24/76 (31%), Gaps = 3/76 (3%) Frame = -1 Query: 604 GXEXXGXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXGGGGXXKXG 425 G G GGGG G GGGA G G GGGG G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGA-GNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGG 86 Query: 424 XXQXXG---GGXXGGG 386 G GG GGG Sbjct: 87 AAGAAGAGAGGNVGGG 102 Score = 30.3 bits (65), Expect = 1.4 Identities = 25/87 (28%), Positives = 25/87 (28%), Gaps = 1/87 (1%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGG-GXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXX 470 G G G G GG G G G G G GGG GG GA Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGG-GGAGNGGGGGGAGNGGA 87 Query: 469 XXXXKXGGGGXXKXGXXQXXGGGXXGG 389 G GG G GG G Sbjct: 88 AGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -3 Query: 629 GXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G G GG GGG G G G G GGGGGG Sbjct: 31 GVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGG 81 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXG-GXPXXXXGGGGGG 477 GG G G GG GGG G G G G G G G G GG Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGG 97 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 PP PPPP P PPPP P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 35.5 bits (78), Expect = 0.038 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXPXP 620 PPPP P P PP P PP P P Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 33.9 bits (74), Expect = 0.12 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXP 590 P PP +P PP P PPPP P Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 PPPP P PPPP S PP P P P Sbjct: 1157 PPPPPP---PPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPP 452 PPP PPP PS PPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPP 1179 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPP 452 PPP PPP P PPPP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPP 1181 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPP 452 PPP PPP P PPPP Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPP 1182 Score = 27.9 bits (59), Expect(2) = 1.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPP 452 PPP PPP PS PPPP Sbjct: 1157 PPPPPPPPP--PPPSSPSPPPP 1176 Score = 21.4 bits (43), Expect(2) = 1.0 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +3 Query: 513 APXXPPXXGAPPPP 554 +P PP PPPP Sbjct: 1170 SPSPPPPPPPPPPP 1183 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G GG G GG GGGGGG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G G G GG G GGGG G GGGG GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G G G GG G GGGG G GGGG GG G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGA 512 G G GG G GGGG G GGGG GG GA Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGA 702 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGA 512 G G GG G GGGG G GGGG GG GA Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGA 705 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGA 512 G G G G GG G GGGG G GGGG G GA Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGA 707 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGA 512 G G G G GG G GGGG G GGGG G GA Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGA 709 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G G G GG G GGGG G GGGGA G G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGG 480 GG GGGG G G GG G GG GGGGG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 596 GXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G GGGG G G GG G GG GGGGGG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G GG G GG GGGG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G GG G GG GGG GG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G GGGG G G GG G GG GGGGGG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G GGGG G G GG G GG GGGGGG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 35.1 bits (77), Expect = 0.050 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G GG G GG G GG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 35.1 bits (77), Expect = 0.050 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G GG G GG GG G G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 33.5 bits (73), Expect = 0.15 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 629 GXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G G GG GGGG G G GG G GG G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 31.5 bits (68), Expect = 0.62 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGG 486 G G G GG GGGG G G GG G GG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 31.1 bits (67), Expect = 0.82 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 G G G G GG G GGGG G G GA G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 654 GLXGXGXXXXGXXXXVXGXRXXGXGGGXXGXGXGVGGXRPXXGXGXG 514 G G G G G G GGG G G G GG G G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.1 bits (87), Expect = 0.003 Identities = 25/79 (31%), Positives = 26/79 (32%) Frame = +3 Query: 369 PXFXXXPPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPP 548 P F PP PP P+ PPPP AP PP APP Sbjct: 43 PHFISSSPPPPPPSPPAAAPA--APPPPA-----AAPAAPPPPAAPPAAPPPPPPLPAPP 95 Query: 549 PPXPXXXXPPPPXPXXSXP 605 PP PPP P P Sbjct: 96 PPPAQPAPQPPPAPPHFLP 114 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +3 Query: 513 APXXPPXXGA----PPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 AP PP A PPPP PPPP P + PP P P P Sbjct: 61 APAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 34.3 bits (75), Expect = 0.088 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +3 Query: 516 PXXPPX-----XGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 P PP APPPP PPPP + PP P P P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 +P PP P PP PPPP + PP P P P Sbjct: 49 SPPPPP----PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 PP P P P PPP PP P P PP Sbjct: 54 PPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXP 645 PP PP P PPPP PP P P P Sbjct: 67 PPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 PP A PP P PPPP P P P P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 39.1 bits (87), Expect = 0.003 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 PPP PP S PPPP P P AP PP P Sbjct: 264 PPPKNAPPPPKRGSS--NPPPPP------TRGPPSNSFTTQGPPLPPSRDQAPAPPPPLN 315 Query: 567 XXPPPPXPXXSXPPXPXP 620 PPPP P P P P Sbjct: 316 ATPPPPPPSRDQVPLPPP 333 Score = 34.7 bits (76), Expect = 0.067 Identities = 22/82 (26%), Positives = 23/82 (28%) Frame = +3 Query: 402 PPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXXXXPPP 581 PPP P PPPP P PP PPPP Sbjct: 207 PPPERSSGP----PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGE 262 Query: 582 PXPXXSXPPXPXPXXXXXXPXP 647 P P + PP P P P Sbjct: 263 PPPPKNAPPPPKRGSSNPPPPP 284 Score = 33.1 bits (72), Expect = 0.20 Identities = 28/104 (26%), Positives = 29/104 (27%), Gaps = 11/104 (10%) Frame = +3 Query: 375 FXXXPPPXXPPPXXWXXPSFXX--------PPPPXFXXXXXXXXXXXXXXXXXXAPXXPP 530 F PP PPP P+F PPPP P P Sbjct: 165 FPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGP 224 Query: 531 XXG--APPPPXPXXXXP-PPPXPXXSXPPXPXPXXXXXXPXPXN 653 APPP P PPP PP P P P N Sbjct: 225 SQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKN 268 Score = 32.7 bits (71), Expect = 0.27 Identities = 27/89 (30%), Positives = 28/89 (31%), Gaps = 5/89 (5%) Frame = +3 Query: 369 PXFXXXPPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXX---- 536 P PPP PPP P PPP AP PP Sbjct: 312 PPLNATPPP--PPPSRDQVP--LPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQP 367 Query: 537 -GAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 G PPPP P PP + PP P P Sbjct: 368 LGGPPPPPPGRR---PPSGKINPPPPPPP 393 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXP 614 PPPP P PPP P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 29.5 bits (63), Expect = 2.5 Identities = 23/87 (26%), Positives = 24/87 (27%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 PP P P PPPP AP PP G+ PP P Sbjct: 232 PPTGSSRPLPAPPPGENRPPPPM-----RGPTSGGEPPPPKNAPP-PPKRGSSNPPPPPT 285 Query: 567 XXPPPPXPXXSXPPXPXPXXXXXXPXP 647 PP PP P P P Sbjct: 286 RGPPSNSFTTQGPPLPPSRDQAPAPPP 312 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPPQ 651 PP PP P PPPP + P P P PQ Sbjct: 321 PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQ 366 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +3 Query: 516 PXXPPXXGAPPPP-XPXXXXPPPP 584 P PP G PPPP P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 8/36 (22%) Frame = +3 Query: 525 PPXXGAPPPP--------XPXXXXPPPPXPXXSXPP 608 PP GAPPPP P PPP P PP Sbjct: 141 PPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPP 176 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 537 GAPPPPXPXXXXPPPP 584 GAPPP P PPPP Sbjct: 462 GAPPPVPPSRGPPPPP 477 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 AP PP GAPPP P PPPP P + P P Sbjct: 216 APPPPPTTGAPPPT-PVTNKPPPPRPATTQAPPP 248 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 PP PPPP PPP P + PP P P P Sbjct: 212 PPTAAPPPPPTTGA---PPPTPVTNKPPPPRPATTQAPP 247 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 39.1 bits (87), Expect = 0.003 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 PPP PP S PPPP P P AP PP P Sbjct: 176 PPPKNAPPPPKRGSS-NPPPPP-------TRGPPSNSFTTQGPPLPPSRDQAPAPPPPLN 227 Query: 567 XXPPPPXPXXSXPPXPXP 620 PPPP P P P P Sbjct: 228 ATPPPPPPSRDQVPLPPP 245 Score = 34.7 bits (76), Expect = 0.067 Identities = 22/82 (26%), Positives = 23/82 (28%) Frame = +3 Query: 402 PPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXXXXPPP 581 PPP P PPPP P PP PPPP Sbjct: 119 PPPERSSGP----PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGE 174 Query: 582 PXPXXSXPPXPXPXXXXXXPXP 647 P P + PP P P P Sbjct: 175 PPPPKNAPPPPKRGSSNPPPPP 196 Score = 33.1 bits (72), Expect = 0.20 Identities = 28/104 (26%), Positives = 29/104 (27%), Gaps = 11/104 (10%) Frame = +3 Query: 375 FXXXPPPXXPPPXXWXXPSFXX--------PPPPXFXXXXXXXXXXXXXXXXXXAPXXPP 530 F PP PPP P+F PPPP P P Sbjct: 77 FPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGP 136 Query: 531 XXG--APPPPXPXXXXP-PPPXPXXSXPPXPXPXXXXXXPXPXN 653 APPP P PPP PP P P P N Sbjct: 137 SQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKN 180 Score = 32.7 bits (71), Expect = 0.27 Identities = 27/89 (30%), Positives = 28/89 (31%), Gaps = 5/89 (5%) Frame = +3 Query: 369 PXFXXXPPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXX---- 536 P PPP PPP P PPP AP PP Sbjct: 224 PPLNATPPP--PPPSRDQVP--LPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQP 279 Query: 537 -GAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 G PPPP P PP + PP P P Sbjct: 280 LGGPPPPPPGRR---PPSGKINPPPPPPP 305 Score = 29.5 bits (63), Expect = 2.5 Identities = 23/87 (26%), Positives = 24/87 (27%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 PP P P PPPP AP PP G+ PP P Sbjct: 144 PPTGSSRPLPAPPPGENRPPPPM-----RGPTSGGEPPPPKNAPP-PPKRGSSNPPPPPT 197 Query: 567 XXPPPPXPXXSXPPXPXPXXXXXXPXP 647 PP PP P P P Sbjct: 198 RGPPSNSFTTQGPPLPPSRDQAPAPPP 224 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPPQ 651 PP PP P PPPP + P P P PQ Sbjct: 233 PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQ 278 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 8/36 (22%) Frame = +3 Query: 525 PPXXGAPPPP--------XPXXXXPPPPXPXXSXPP 608 PP GAPPPP P PPP P PP Sbjct: 53 PPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPP 88 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 537 GAPPPPXPXXXXPPPP 584 GAPPP P PPPP Sbjct: 374 GAPPPVPPSRGPPPPP 389 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 38.7 bits (86), Expect = 0.004 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -3 Query: 629 GXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGGV 474 G G GG GGGG G G GG G GG GGGGGGV Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDG-GGGGGGGDGGGGGGGGGGGV 113 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G GG G GG GGGG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDG 102 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G G G GG G GGGG G GGG GG G Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 35.1 bits (77), Expect = 0.050 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGG--GGXXXXGXGGGGAPXXGGXXG 515 G G G G GG + G GG GG G GGGG GG G Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 31.9 bits (69), Expect = 0.47 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = -1 Query: 589 GXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXGGGGXXKXGXXQXX 410 G GGGG G GGGG GG G GGGG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDG--------------------DGGGGDGGGGGGGGD 101 Query: 409 GGGXXGGG 386 GGG GGG Sbjct: 102 GGGGGGGG 109 Score = 31.5 bits (68), Expect = 0.62 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 607 GGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 GG G GGGG G GGGG GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGG 89 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 604 GXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G GGGG G GGGG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGG 91 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXP 590 AP PP APPPP P PPPP P Sbjct: 92 APACPPACCAPPPPPPPPPPPPPPPP 117 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 528 PXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 P AP P PPPP P PP P P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPP 118 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 517 PXXPXXGAXPPHPXPXXXXPPPPXLXPP 600 P P PP P P PPPP PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXH 609 P P A PP P P PPPP P H Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPPITLH 124 Score = 29.5 bits (63), Expect = 2.5 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = +3 Query: 369 PXFXXXPPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPP 548 P PPP PPP P PPPP P PP PP Sbjct: 96 PPACCAPPPPPPPPPPPPPP----PPPPPITLHHEQHVVSHVMH-----PAPPP----PP 142 Query: 549 PPXPXXXXPP 578 PP P PP Sbjct: 143 PPPPAPCMPP 152 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 P PP APPP P PPP P PP P P Sbjct: 180 PPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAP 214 Score = 35.1 bits (77), Expect = 0.050 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 546 PPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 PPP P PPP P PP P P P P Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPP 212 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/41 (43%), Positives = 20/41 (48%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG R GGGG G+GG + G GG GGG GG Sbjct: 186 GGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGG 226 Score = 33.1 bits (72), Expect = 0.20 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGG 483 GG G G G GG G G G+GG G GG GGGG Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 32.3 bits (70), Expect = 0.35 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGG G G+GG G G G GGGG Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGG 219 Score = 32.3 bits (70), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 G G GG G GGG G GGGG GG Sbjct: 208 GGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGG 239 Score = 31.9 bits (69), Expect = 0.47 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 629 GXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G G GG GG G G G+GG G GG GG GG Sbjct: 194 GYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGG 244 Score = 29.5 bits (63), Expect = 2.5 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = -1 Query: 583 GGGGXXXXGX--GGGGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXGGGGXXKXGXXQXX 410 GGGG G GGGG G G GGGG G Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYG-GGGRHDY 237 Query: 409 GGGXXGGG 386 GGG GGG Sbjct: 238 GGGSKGGG 245 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 A PP PPP P PPP P + PP P P P Sbjct: 445 AATLPPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSP 487 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 37.5 bits (83), Expect = 0.009 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = +3 Query: 390 PPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXXX 569 PP PP P PPPP P G PPP P Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPM 283 Query: 570 XPPPPXPXXSXPPXPXP 620 P P PP P P Sbjct: 284 PPGGMPPNMEQPPPPPP 300 Score = 31.1 bits (67), Expect = 0.82 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +3 Query: 324 PXAFFPPXVXXXNXXPXFXXXPPPXXPP--PXXWXXPSFXXPPPP 452 P PP P PPP PP P P+ PPPP Sbjct: 254 PPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPP 298 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +1 Query: 526 PXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 P PPH P PPP + PP P PP Sbjct: 237 PMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPP 277 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 5/50 (10%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXP-----PPPXLXPPXXHXXXXPXPXXXXPP 648 PP P G PP P P PPP + PP P PP Sbjct: 249 PPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPP 298 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/65 (26%), Positives = 17/65 (26%), Gaps = 1/65 (1%) Frame = +3 Query: 369 PXFXXXPPPXXPPPXXWXXPSFXXPPP-PXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAP 545 P PPP PP P PP P PP P Sbjct: 236 PPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQP 295 Query: 546 PPPXP 560 PPP P Sbjct: 296 PPPPP 300 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 P P PP P P PP P P S PP P P Sbjct: 245 PTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTP 279 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 P P PP P P PP P P S PP P P Sbjct: 255 PTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTP 289 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 P P PP P P PP P P S PP P P Sbjct: 265 PTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPHP 299 Score = 35.9 bits (79), Expect = 0.029 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 528 PXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 P PP P P PP P P S PP P P Sbjct: 239 PNTSIPPTPTPHTSIPPTPTPHTSIPPTPTP 269 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 P P PP P P PP P P P P Sbjct: 275 PTPTPHTSIPPTPTPHTSIPPTPHPTYKHPSYSYP 309 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 549 PPXPXXXXPPPPXPXXSXPPXPXP 620 P P PP P P S PP P P Sbjct: 236 PLIPNTSIPPTPTPHTSIPPTPTP 259 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.1 bits (82), Expect = 0.012 Identities = 37/130 (28%), Positives = 37/130 (28%), Gaps = 3/130 (2%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXG-WGGXAPXXGXXGGXPXXXXG--GGGGG 477 GG G G GG GGGG G G GG G GG G GGGGG Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Query: 476 VWVXXXKXXGGRXXKRXXXPXXXGGXXXGXXXXKXXGXVXXVXPGGKKXXGGAKXXXXGX 297 GG GG G G GG GG G Sbjct: 302 A----TGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGG 357 Query: 296 XGXXXXFXDG 267 G DG Sbjct: 358 PGSGGCGEDG 367 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = -3 Query: 596 GXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXG--GGGGG 477 G GGG G GG G GG G GGGGG Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 280 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 652 FXGXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXG 527 F G G G G GG G GGGG G GGGG G Sbjct: 87 FGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 37.1 bits (82), Expect = 0.012 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G GG G GGGG G GGGG GG G Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 35.9 bits (79), Expect = 0.029 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G GG G GGGG G GGGG GG G Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 35.1 bits (77), Expect = 0.050 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G GG G GG GGGGGG Sbjct: 89 GGGGFGGGGGGGFGGGGGG---GFGGGGGGGGGFGGGGGGG 126 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G GG G GGGG G GGG GG G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGG 118 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 G G G GG G GGGG G GGGG GG Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 31.1 bits (67), Expect = 0.82 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -3 Query: 584 GGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G GG G G+GG G GG GGGGGG Sbjct: 82 GRGGGFGGGGGFGGGG-GGGFGGGGGGGFGGGGGGG 116 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 604 GXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G GGGG G GGG GG G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFG 110 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G GG G GGGG G GGGG GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G GG G GGGG G GGGG GG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 34.3 bits (75), Expect = 0.088 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 584 GGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGG 480 GGGG G G GG G GG GGGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 34.3 bits (75), Expect = 0.088 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 581 GGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GGG G G GG G GG GGGGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGG 542 G G G G GG G GGGG G GGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 584 GGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GGGG G G GG G GG GGGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 36.7 bits (81), Expect = 0.016 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -3 Query: 629 GXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G W GG GGGG G G GG G G P GGGGG Sbjct: 216 GGRSVWNGVPGGF-GGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGG 265 Score = 33.1 bits (72), Expect = 0.20 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 4/72 (5%) Frame = -1 Query: 589 GXGGGGXXXXGXGG---GGAPXXGGXXG-AXXXXXXXXXXXXXXXXXXKXGGGGXXKXGX 422 G GGGG G G GGA GG G A GGGG G Sbjct: 180 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGG 239 Query: 421 XQXXGGGXXGGG 386 GGG GGG Sbjct: 240 GGGGGGGYSGGG 251 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 652 FXGXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 F G G G G GG G G G GGGG G Sbjct: 228 FGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSG 270 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 36.3 bits (80), Expect = 0.022 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 8/48 (16%) Frame = +3 Query: 528 PXXGAPPPPXPXXXX--------PPPPXPXXSXPPXPXPXXXXXXPXP 647 P G PPPP P PPPP P + PP P P P P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPP 703 Score = 35.9 bits (79), Expect = 0.029 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXPXP 620 PPPP P PPPP P P P P Sbjct: 679 PPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 32.3 bits (70), Expect = 0.35 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +3 Query: 516 PXXPPXXG--APPPPXPXXXXPPPPXP 590 P PP G APPPP P PPP P Sbjct: 678 PPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXP 560 PPP PPP PPPP P P GAPPPP P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPL------------PGGAAPPPPPPIGGGAPPPPPP 705 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXP 590 P P PPPP PPPP P Sbjct: 681 PPLPGGAAPPPPPPIGGGAPPPPPP 705 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 36.3 bits (80), Expect = 0.022 Identities = 20/58 (34%), Positives = 22/58 (37%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGGV 474 GG G G GG GGGG G +GG G GGGGGG+ Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGM 1817 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G G A G G GGGGGG Sbjct: 1806 GGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 35.5 bits (78), Expect = 0.038 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G GG G GG GGG G Sbjct: 1801 GGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAG 1841 Score = 32.7 bits (71), Expect = 0.27 Identities = 27/91 (29%), Positives = 27/91 (29%), Gaps = 2/91 (2%) Frame = -1 Query: 652 FXGXGXXXXXXGXGCGGXEXXGXGGGGXXXXG--XGGGGAPXXGGXXGAXXXXXXXXXXX 479 F G G G G G GGGG G GGG GG G Sbjct: 1758 FGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGM 1817 Query: 478 XXXXXXXKXGGGGXXKXGXXQXXGGGXXGGG 386 GGG G GGG GGG Sbjct: 1818 GGGGEGMGAAGGGMGAGGEGGGAGGG--GGG 1846 Score = 32.7 bits (71), Expect = 0.27 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G G GG GGG G G G G G GGGGG Sbjct: 1789 GGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 32.3 bits (70), Expect = 0.35 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G GG GGGG G G GG G G GG G G Sbjct: 1778 GGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAG 1834 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = -3 Query: 644 GXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGG--GGGG 477 G G G GG GGG G G GG A G GG GG GGGG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGG-----GMGGGGMAAGGGEFGGGEGMGGGGMAGGGG 1808 Score = 30.3 bits (65), Expect = 1.4 Identities = 23/90 (25%), Positives = 25/90 (27%) Frame = -3 Query: 560 GXGWGGXAPXXGXXGGXPXXXXGGGGGGVWVXXXKXXGGRXXKRXXXPXXXGGXXXGXXX 381 G G GG G GG G GGGG+ + GG GG G Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGG 1816 Query: 380 XKXXGXVXXVXPGGKKXXGGAKXXXXGXXG 291 G GG G G G Sbjct: 1817 MGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 35.9 bits (79), Expect = 0.029 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXG-WGGXAPXXGXXGGXPXXXXGGGGGGVWVXXXKXXGG 444 GG R GGGG G +GG G GG GGG GG + + GG Sbjct: 94 GGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGG 146 Score = 31.1 bits (67), Expect = 0.82 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = -3 Query: 644 GXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G G + GG GG G G GG G GG GGG GG Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGG 139 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = -3 Query: 629 GXGXXWXWXXGGXRXGGG-GXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G G GG R GGG G G G+GG G GG G GGG Sbjct: 102 GYGGSSRGGYGGGRGGGGYGGGRGGGGYGG-GRGGGYGGGRRDYGGGSKGGG 152 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = -1 Query: 583 GGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXGGGGXXKXGXXQXXGG 404 G GG G GG G G GG G G + GG Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGG 146 Query: 403 GXXGGG 386 G GGG Sbjct: 147 GSKGGG 152 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 35.9 bits (79), Expect = 0.029 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 PP PPPP PPPP P PP P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 35.5 bits (78), Expect = 0.038 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 528 PXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 P G PPPP P PPP P + PP P P P Sbjct: 190 PMAGMPPPPPPP---PPPGFPGGAPPPPPPPFGAPPPP 224 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 516 PXXPPXX--GAPPPPXPXXXXPPPPXPXXSXPP 608 P PP GAPPPP P PPPP PP Sbjct: 200 PPPPPGFPGGAPPPPPPPFGAPPPPA-LNGGPP 231 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXF 458 PPP PPP PPPP F Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPF 218 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +3 Query: 369 PXFXXXPPPXXPPPXXWXXPSFXXPPPP 452 P PPP PPP + + PPPP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPP 217 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 35.9 bits (79), Expect = 0.029 Identities = 31/99 (31%), Positives = 31/99 (31%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXGGGG 440 G GG GGGG G GGG GG GA GGG Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATG----------GGGGA 89 Query: 439 XXKXGXXQXXGGGXXGGGXXKKXGXXFXLXTXGGKXAXG 323 G GGG GGG G T GG A G Sbjct: 90 TGDGGGATGGGGGATGGGGGATGGHGG--ATGGGVGATG 126 Score = 35.9 bits (79), Expect = 0.029 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXG-WGGXAPXXGXXGGXPXXXXGGGGGGV 474 GG G G GG GGGG G G GG G GG G GGGV Sbjct: 64 GGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGV 122 Score = 35.1 bits (77), Expect = 0.050 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 3/90 (3%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXG---GGGAPXXGGXXGAXXXXXXXXXXXX 476 G G G G G GGGG G G GGG GG GA Sbjct: 84 GGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGA----TGGHGGAT 139 Query: 475 XXXXXXKXGGGGXXKXGXXQXXGGGXXGGG 386 GGGG G GGG GG Sbjct: 140 GGHGGATGGGGGATGGGGGATGGGGGATGG 169 Score = 34.7 bits (76), Expect = 0.067 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 3/85 (3%) Frame = -1 Query: 613 GCGGXEXXGXG--GGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXG-GG 443 G GG G G GGG G GGG GG G G GG Sbjct: 85 GGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGG 144 Query: 442 GXXKXGXXQXXGGGXXGGGXXKKXG 368 G GGG GGG G Sbjct: 145 ATGGGGGATGGGGGATGGGGGATGG 169 Score = 33.9 bits (74), Expect = 0.12 Identities = 31/109 (28%), Positives = 31/109 (28%), Gaps = 1/109 (0%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXX 467 G G G G G GGGG G GGG GG G Sbjct: 63 GGGGGATGGGGGATGGHGGATGGGG-GATGDGGGATGGGGGATGGGGGATGGHGGATGGG 121 Query: 466 XXXKXG-GGGXXKXGXXQXXGGGXXGGGXXKKXGXXFXLXTXGGKXAXG 323 G GG G GG GGG G T GG A G Sbjct: 122 VGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGG--ATGGGGGATG 168 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -3 Query: 596 GXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXG--GGGGG 477 G GGGG G GG G GG G GGGGG Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGG 88 Score = 29.9 bits (64), Expect = 1.9 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXG--GGGGG 477 GG G G GG GGG G GG G GG G GGGGG Sbjct: 47 GGATGGGGGATGGGATGG---GGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGG 102 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGG-XXXXGXGWGGXAPXXGXXGGXPXXXXGGGGG 480 GG G G GG GGGG G GG G GG G GG Sbjct: 85 GGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGG 141 Score = 28.7 bits (61), Expect = 4.4 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 2/59 (3%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXG--GGGGG 477 GG G G G GG G GG G GG G GGGGG Sbjct: 107 GGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGG 165 Score = 28.3 bits (60), Expect = 5.8 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXG-WGGXAPXXGXXGGXPXXXXG--GGGGG 477 GG G G GG G GG G G GG G GG G GGGGG Sbjct: 93 GGGATGGGGGA-TGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGG 151 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 35.9 bits (79), Expect = 0.029 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXPXP 620 PPPP PPPP P PP P P Sbjct: 303 PPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP P PPPP P PP P P P P Sbjct: 282 PPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPP 325 Score = 31.9 bits (69), Expect = 0.47 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +3 Query: 516 PXXPPXXGA--PPPPXPXXXXPPPPXP 590 P PP A PPPP P PPPP P Sbjct: 302 PPPPPTDFAPPPPPPEPTSELPPPPPP 328 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 35.5 bits (78), Expect = 0.038 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G GG G GGGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGG 81 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G G G GGGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 35.5 bits (78), Expect = 0.038 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP GAPP P PP P PP P P P Sbjct: 2181 PSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSGSHSPAP 2224 Score = 33.5 bits (73), Expect = 0.15 Identities = 27/97 (27%), Positives = 28/97 (28%), Gaps = 3/97 (3%) Frame = +3 Query: 339 PPXVXXXNXXPXFXXXPPPXXP---PPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXX 509 PP + N P P P PP S PPPP Sbjct: 2115 PPSMGRYNTPPPMGQYGAPARPAMGPPPM--GSSRYGPPPPM----GPARHSPSGPSPLG 2168 Query: 510 XAPXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 P PP GAPP P PP P PP P Sbjct: 2169 APPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHP 2205 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 35.5 bits (78), Expect = 0.038 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGG 480 G + GG G GWG P G GG P G GGG Sbjct: 507 GAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGG 546 Score = 34.7 bits (76), Expect = 0.067 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGG 480 GG G G W G GGG G G GG P G P G GGG Sbjct: 545 GGPPPPGAGQGWGQPPPGAGQGGG-PPPPGAGQGGPPPPGAGQEGPPPPGAGQGGG 599 Score = 34.7 bits (76), Expect = 0.067 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 537 GAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 G PPPP PPPP PP P P P Sbjct: 567 GGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Score = 33.5 bits (73), Expect = 0.15 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G G W G GGG G G GG P G G G G GG Sbjct: 512 GGPPPPGAGQGWGQPPPG-AGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGG 567 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGG 483 G + GG G GWG P G GG P G GG Sbjct: 540 GAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGG 578 Score = 31.9 bits (69), Expect = 0.47 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 560 GXGWGGXAPXXGXXGGXPXXXXGGGGG 480 G GWG P G GG P G GGG Sbjct: 487 GQGWGQPPPGAGQGGGPPPPGAGQGGG 513 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 629 GXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G G W G GGG G G GG P G G G G GG Sbjct: 485 GGGQGWGQPPPGAGQGGG-PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGG 534 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +3 Query: 537 GAPPPPXPXXXXPPPPXP-XXSXPPXPXPXXXXXXPXP 647 G PPPP PPPP PP P P P Sbjct: 577 GGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPP 614 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 508 GXPPXXPXXGAXPPHPXPXXXXPPPP 585 G PP G PP P PPPP Sbjct: 557 GQPPPGAGQGGGPPPPGAGQGGPPPP 582 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 537 GAPPPPXPXXXXPPPPXPXXSXPPXP 614 G PPP PPPP PP P Sbjct: 557 GQPPPGAGQGGGPPPPGAGQGGPPPP 582 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 35.1 bits (77), Expect = 0.050 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 A PP APPPP P PPPP P P P Sbjct: 69 AAATPPPLCAPPPP-PPPPPPPPPPPGAKKPDDP 101 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 35.1 bits (77), Expect = 0.050 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXP 614 PPPP P PPPP P S P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPP 608 PPPP P PPPP P S P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 35.1 bits (77), Expect = 0.050 Identities = 28/99 (28%), Positives = 31/99 (31%), Gaps = 2/99 (2%) Frame = +3 Query: 324 PXAFFPPXVXXXNXXPXFXXXPPPXXP--PPXXWXXPSFXXPPPPXFXXXXXXXXXXXXX 497 P A P + P P P P PP + P+ PP F Sbjct: 262 PPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPA----PPNLFIPSAPPNPHIPPA 317 Query: 498 XXXXXAPXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 P PP PP P P PP P P S PP P Sbjct: 318 PPNPYIPTAPPNPSIPPAP-PNPSIPPAP-PNPSIPPAP 354 Score = 32.3 bits (70), Expect = 0.35 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPP-XPXPXXXXXXPXP 647 AP P APP P P PP P PP P P P P Sbjct: 223 APLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNP 268 Score = 31.1 bits (67), Expect = 0.82 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 5/48 (10%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPP-----XPXPXXXXXXPXPXN 653 PP APP P P PP P PP P P P P N Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPN 235 Score = 30.3 bits (65), Expect = 1.4 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = +3 Query: 513 APXXPPXXGAPP-PPXPXXXXPP-----PPXPXXS--XPPXPXPXXXXXXPXP 647 AP PP APP PP P PP PP P P P P P P Sbjct: 193 APPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNP 245 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 A PP P PP PP P S PP P P P Sbjct: 241 ATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNP 285 Score = 29.1 bits (62), Expect = 3.3 Identities = 26/88 (29%), Positives = 26/88 (29%), Gaps = 1/88 (1%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 P P PP PS PP P P PP PP P P Sbjct: 266 PNPSIPPAPP--NPSIPAPPNPSIPLAPPNPYIPPAPPNLFI-PSAPPNPHIPPAP-PNP 321 Query: 567 XXPPPPXPXXSXPP-XPXPXXXXXXPXP 647 P P P S PP P P P P Sbjct: 322 YIPTAP-PNPSIPPAPPNPSIPPAPPNP 348 Score = 27.9 bits (59), Expect = 7.6 Identities = 21/90 (23%), Positives = 22/90 (24%), Gaps = 4/90 (4%) Frame = +3 Query: 390 PPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXG----APPPPX 557 PP P P P+ PP P PP P PP Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPM 247 Query: 558 PXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP P P P P P Sbjct: 248 PETPLPPATPNPFIPPASPNPSIPPAPPNP 277 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 525 PPXXGAP--PPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 PP P PP P PP P P S P P P P P Sbjct: 253 PPATPNPFIPPASPNPSIPPAP-PNPSIPAPPNPSIPLAPPNP 294 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 35.1 bits (77), Expect = 0.050 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 A PP APPPP P PPPP P P P Sbjct: 270 AAATPPPLCAPPPP-PPPPPPPPPPPGAKKPDDP 302 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 35.1 bits (77), Expect = 0.050 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -3 Query: 590 RXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGGVWVXXXKXXGG 444 R GGG G G GG G GG GGGGGG + GG Sbjct: 91 RGGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGG 139 Score = 33.5 bits (73), Expect = 0.15 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G +GG G GG GGGGGG Sbjct: 105 GGGYGGGGGYGGGGRSYGG----GGGGGGFYQDSYGGGGGG 141 Score = 33.1 bits (72), Expect = 0.20 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = -3 Query: 584 GGGGXXXXGX--GWGGXAPXXGXXGGXPXXXXGGGGGGVWVXXXKXXGG 444 GGGG G G GG G GG GGGGGG + GG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGG 140 Score = 32.3 bits (70), Expect = 0.35 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = -3 Query: 584 GGGGXXXXGXGWGGXAPXXGXXGGX----PXXXXGGGGGGVW 471 GGGG G G+GG G GG GGGGGG + Sbjct: 103 GGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGGCY 144 Score = 31.9 bits (69), Expect = 0.47 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGG G G GG + G GG GGGGG Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGG 140 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 613 GCGGXEXXGXGGGGXXXXGXG-GGGAPXXGGXXG 515 G G E G GGGG G G GGG GG G Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGG 126 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXG--GGGXXXXGXGGGG 542 G G G G GG G G GGG G GGGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGG---XXXXGXGGGG 542 G G G G GG G GGGG G GGGG Sbjct: 104 GGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 34.7 bits (76), Expect = 0.067 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 AP PP PPP PPPP P + P P Sbjct: 319 APAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 31.1 bits (67), Expect = 0.82 Identities = 26/90 (28%), Positives = 26/90 (28%), Gaps = 6/90 (6%) Frame = +3 Query: 390 PPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXX-APXXPPXXGAP---PPPX 557 PP PP P PPPP AP PP P PPP Sbjct: 371 PPGMRPPGAGNGPG--GPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPP 428 Query: 558 PXXXX--PPPPXPXXSXPPXPXPXXXXXXP 641 P PPPP P P P P Sbjct: 429 PGFPQFQPPPPPPPSDAPWIERPKRFENNP 458 Score = 29.1 bits (62), Expect = 3.3 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 4/86 (4%) Frame = +3 Query: 375 FXXXPPPXXPPPXXWXXPSFXXPP--PPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPP 548 F PPP PP PS PP P P P PP Sbjct: 318 FAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPP 377 Query: 549 PPXPXXXXPPPP--XPXXSXPPXPXP 620 PPPP P P P P Sbjct: 378 GAGNGPGGPPPPWSKPGGILPGPPPP 403 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 528 PXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 P AP PP P PPP + PP P P P Sbjct: 315 PAAFAPAPP-PSQAPPPPKTIPSTLPPPPVPSATSAPP 351 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 34.7 bits (76), Expect = 0.067 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G GC G G GGGG G GGGG GG G Sbjct: 77 GGGCDGGGGDGDGGGG--GDGDGGGGGDGGGGGDG 109 Score = 31.9 bits (69), Expect = 0.47 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGG--GXXXXGXGGGGAPXXGGXXG 515 G G G G G + G GGG G G GGGG GG G Sbjct: 56 GDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGG 101 Score = 31.1 bits (67), Expect = 0.82 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXG 527 G G GG + G GGG G GGGG G Sbjct: 87 GDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 G G GG G GGGG G GGGG GG Sbjct: 85 GDGDGGGGGDGDGGGG----GDGGGGGDGGGG 112 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 607 GGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 GG + G GGG G GGG GG G Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDG 103 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G G G GG G GGGG Sbjct: 77 GGGCDGGGGDGDGGGGGDGDGGGGGDGGGG-----GDGGGG 112 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 34.7 bits (76), Expect = 0.067 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 AP P PPPP PP P PP P P P P Sbjct: 545 APAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPP 589 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 516 PXXPPXXGAPPP-PXPXXX--XPPPPXPXXSXPPXP 614 P PP PPP P PPPP P PP P Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PPPP P PP PP P P P Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 34.7 bits (76), Expect = 0.067 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G GC G G GGGG G GGGG GG G Sbjct: 92 GGGCDGGGGDGDGGGG--GDGDGGGGGDGGGGGDG 124 Score = 31.9 bits (69), Expect = 0.47 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGG--GXXXXGXGGGGAPXXGGXXG 515 G G G G G + G GGG G G GGGG GG G Sbjct: 71 GDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGG 116 Score = 31.1 bits (67), Expect = 0.82 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXG 527 G G GG + G GGG G GGGG G Sbjct: 102 GDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 G G GG G GGGG G GGGG GG Sbjct: 100 GDGDGGGGGDGDGGGG----GDGGGGGDGGGG 127 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 607 GGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 GG + G GGG G GGG GG G Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDG 118 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G G G GG G GGGG Sbjct: 92 GGGCDGGGGDGDGGGGGDGDGGGGGDGGGG-----GDGGGG 127 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 34.7 bits (76), Expect = 0.067 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGA 512 G G GG G GGGG G GGGG G GA Sbjct: 142 GMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGGA 177 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G GG G GGGG G GGGG G G Sbjct: 132 GMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGG 166 >SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 34.3 bits (75), Expect = 0.088 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -1 Query: 613 GCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGA 512 G GG E G GGGG GGGG GG G+ Sbjct: 213 GKGGWENGGFGGGGSAMAHPGGGGGYSGGGIEGS 246 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 623 GXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGG 483 G W GG GGGG G GG G G GGGG Sbjct: 212 GGKGGWENGGF--GGGGSAMAHPGGGGGYSGGGIEGSETTGSAGGGG 256 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 34.3 bits (75), Expect = 0.088 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPP 608 PP GAPPPP PPPP S P Sbjct: 197 PPPSGAPPPPPIGAPPPPPPDDDVSMTP 224 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 34.3 bits (75), Expect = 0.088 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 525 PPXXGAPPP--PXPXXXXPPPPXPXXSXPPXPXP 620 PP G PPP P PPPP P P P P Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 34.3 bits (75), Expect = 0.088 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 3/71 (4%) Frame = -1 Query: 589 GXGGGGXXXXGXGG---GGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXGGGGXXKXGXX 419 G GGGG G G GGA GG G GGGG G Sbjct: 441 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGG 500 Query: 418 QXXGGGXXGGG 386 GGG GG Sbjct: 501 GGGGGGGFSGG 511 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 589 GXGGGGXXXXGXGGGGAPXXGGXXG 515 G GGG G GGGG GG G Sbjct: 490 GGGGGASGGGGGGGGGGGFSGGACG 514 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 34.3 bits (75), Expect = 0.088 Identities = 29/108 (26%), Positives = 29/108 (26%) Frame = +3 Query: 318 GXPXAFFPPXVXXXNXXPXFXXXPPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXX 497 G P FPP P P P PPP P PPP Sbjct: 435 GAPHPRFPPPGAPHPRVPP-PGAPHPRVPPPGA---PHPRVPPP----GAPHPRVPPPGA 486 Query: 498 XXXXXAPXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 P P PPP P PPP P PP P P Sbjct: 487 PHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 534 Score = 33.1 bits (72), Expect = 0.20 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 4/89 (4%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXG----APPPP 554 P P PPP P F P P P PP PPP Sbjct: 427 PHPRVPPPGA-PHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPG 485 Query: 555 XPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 P PPP P PP P P Sbjct: 486 APHPRVPPPGAPHQRVPPPGAPHPRVPPP 514 Score = 31.5 bits (68), Expect = 0.62 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 2/87 (2%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXP--PPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXP 560 PPP P P P P PPP P P PPP P Sbjct: 472 PPPGAPHPRV-PPPGAPHPRVPPPG---APHQRVPPPGAPHPRVPPPGAPHPRVPPPGAP 527 Query: 561 XXXXPPPPXPXXSXPPXPXPXXXXXXP 641 PPP P PP P P Sbjct: 528 HPRVPPPGAPHPRVPPPGAPHPRVPPP 554 Score = 31.5 bits (68), Expect = 0.62 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 2/87 (2%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXP--PPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXP 560 PPP P P P P PPP P P PPP P Sbjct: 522 PPPGAPHPRV-PPPGAPHPRVPPPG---APHPRVPPPGASHPRVPPPGAPHPRVPPPGAP 577 Query: 561 XXXXPPPPXPXXSXPPXPXPXXXXXXP 641 PPP P PP P P Sbjct: 578 HPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 31.5 bits (68), Expect = 0.62 Identities = 23/80 (28%), Positives = 23/80 (28%), Gaps = 2/80 (2%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXP--PPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXP 560 PPP P P P P PPP P P PPP P Sbjct: 532 PPPGAPHPRV-PPPGAPHPRVPPPG---ASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP 587 Query: 561 XXXXPPPPXPXXSXPPXPXP 620 PPP P PP P Sbjct: 588 HPRVPPPGAPHPKVPPPGAP 607 Score = 31.1 bits (67), Expect = 0.82 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 P P PPP P PPP P PP P P Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPP 464 Score = 28.7 bits (61), Expect = 4.4 Identities = 25/93 (26%), Positives = 25/93 (26%), Gaps = 15/93 (16%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPP--------PPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGA 542 PP PPP P PP PP P P A Sbjct: 312 PPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPPPDGPYTRA 371 Query: 543 PPPPXPXXXXPPP-------PXPXXSXPPXPXP 620 PP P PPP P P S P P P Sbjct: 372 LPPGEPYARMPPPGATHPRVPSPGASHPRVPPP 404 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXP 605 PP APPPP PPPP P P Sbjct: 227 PPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 33.5 bits (73), Expect = 0.15 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPP 608 P PP PPP P PPPP P P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +3 Query: 516 PXXPPXXG--APPPPXPXXXXPPPPXPXXSXPPXPXP 620 P PP P PP P PPPP P + PP P P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPP-PAAAPPPPPPP 247 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 549 PPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 PP P P PP P PP P P P Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPP 247 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPP 584 AP PP A PPP P PPPP Sbjct: 230 APAPPPPPAAAPPPPP----PPPP 249 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 544 PPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 PP P PPPP P P P PP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 P P G PPP P PPP P PP P P Sbjct: 44 PPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPP 85 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 P P G PPP P PPP P PP P P Sbjct: 64 PPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPP 105 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 P P G PPP P PPP P PP P P Sbjct: 74 PPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 P P G PPP P PPP P PP P Sbjct: 84 PPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTP 118 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 P P G PPP P PPP P PP P P Sbjct: 54 PPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPP 95 Score = 29.9 bits (64), Expect = 1.9 Identities = 22/75 (29%), Positives = 23/75 (30%), Gaps = 2/75 (2%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXP--PPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXP 560 PPP P P P+ P PPP P P G PPP P Sbjct: 53 PPPNIPIPGN-PPPNTPIPGDPPPN---TPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTP 108 Query: 561 XXXXPPPPXPXXSXP 605 PPP P P Sbjct: 109 IPGDPPPNTPIQGDP 123 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/43 (30%), Positives = 14/43 (32%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXPXN 653 PP P P P P P P + P P P P N Sbjct: 4 PPNTAIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPN 46 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/76 (25%), Positives = 21/76 (27%) Frame = +3 Query: 393 PXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXXXX 572 P P + P+ PP A PP G PP P Sbjct: 104 PPTSQPVAYGYPTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPY 163 Query: 573 PPPPXPXXSXPPXPXP 620 P P P PP P P Sbjct: 164 PAQPYPQQGYPPQPPP 179 Score = 28.7 bits (61), Expect = 4.4 Identities = 21/81 (25%), Positives = 21/81 (25%), Gaps = 3/81 (3%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXP---PXXGAPPPPX 557 PPP P P P PP P P P G PP P Sbjct: 119 PPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPP 178 Query: 558 PXXXXPPPPXPXXSXPPXPXP 620 P P P P P P Sbjct: 179 PQAYPQPGYPPQGYPPTGPYP 199 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 33.5 bits (73), Expect = 0.15 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWG--GXAPXXGXXGGXPXXXXGGGGGG 477 GG G G W GG G GG G G G G G GG GG GGG Sbjct: 122 GGVQRGGRGG-WRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGG 179 Score = 30.7 bits (66), Expect = 1.1 Identities = 23/76 (30%), Positives = 24/76 (31%) Frame = -1 Query: 613 GCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXGGGGXX 434 G GG G G G G G GG GG G GGG Sbjct: 128 GRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGR----------GGGEG 177 Query: 433 KXGXXQXXGGGXXGGG 386 G + GGG GGG Sbjct: 178 GGGRGRGTGGGSRGGG 193 Score = 29.5 bits (63), Expect = 2.5 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGG--GGG 477 GG G G GG GGG G G G G GG GGG GGG Sbjct: 136 GGGEGNGAGGG-IGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGG 193 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 33.5 bits (73), Expect = 0.15 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 PP PPPP PPP P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAP 126 Score = 31.5 bits (68), Expect = 0.62 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 P PP PP P P P PP P PP P Sbjct: 98 PATPPPPTMPPTPPPPQT-PAPPGPDTPAPPAP 129 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Frame = +3 Query: 537 GAPPPP---XPXXXXPPPPXPXXSXPPXP 614 G PPPP P P PP P PP P Sbjct: 93 GDPPPPATPPPPTMPPTPPPPQTPAPPGP 121 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXP 605 P PP P PP P PP P + P Sbjct: 107 PPTPPPPQTPAPPGPDTPAPPAPGGCGAKP 136 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 516 PXXPPXXGAPPP--PXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 P PP +PPP P P PPPP PP P P Sbjct: 1055 PIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNP 1098 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +3 Query: 516 PXXPPXXGAPPP---PXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP +PPP P P P PP + PP P P P Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVP 1086 Score = 32.3 bits (70), Expect = 0.35 Identities = 22/83 (26%), Positives = 22/83 (26%), Gaps = 1/83 (1%) Frame = +3 Query: 369 PXFXXXPPPXXP-PPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAP 545 P PPP P PP P PPPP P PP Sbjct: 1051 PSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPK 1110 Query: 546 PPPXPXXXXPPPPXPXXSXPPXP 614 P P P P PP P Sbjct: 1111 PTPAPRPRSWVESQPELHRPPPP 1133 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 3/44 (6%) Frame = +3 Query: 525 PPXXGAPPP---PXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 PP A PP P P P PP PP P P P Sbjct: 1028 PPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAP 1071 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXP-XPXXXXXXPXP 647 P PP PPPP P PP P P P P P P Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGP 74 Score = 31.5 bits (68), Expect = 0.62 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXPXP 620 PPPP P PPPP P P P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFP 54 Score = 28.7 bits (61), Expect = 4.4 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 2/89 (2%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPP-PXPX 563 PPP PP P F P P P P PP P P Sbjct: 38 PPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPN 97 Query: 564 XXXPPPPXPXXSXPP-XPXPXXXXXXPXP 647 PP PP P P P P Sbjct: 98 GVNGPPGELGDMGPPGPPGPPGPQMPPGP 126 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 573 PPPPXPXXSXPPXPXPXXXXXXP 641 PPPP P + PP P P P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPP 51 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G GG + G GGGG G GGG G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDG 340 Score = 31.5 bits (68), Expect = 0.62 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G GG G GGGG G G GG G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDG 338 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 607 GGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G + G GGG G GGGG GG G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDG 332 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 528 PXXGAPPPPXPXXXX-PPPPXPXXSXPPXPXP 620 P PPPP P PPPP P P P P Sbjct: 190 PWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 31.5 bits (68), Expect = 0.62 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXP 590 P P G PPPP P PPP P Sbjct: 197 PPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 31.1 bits (67), Expect = 0.82 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 537 GAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 G+P P PPPP P P P P P P Sbjct: 183 GSPTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPP 219 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPP 585 PP P G PP P P PPP Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPP 219 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 537 GAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 G PPP P PPPP P P P P P Sbjct: 119 GYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVP 155 Score = 31.1 bits (67), Expect = 0.82 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 516 PXXPPXXGAPPPP-XPXXXXPPPPXPXXSXPPXP 614 P PP PPPP P PP P PP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVP 155 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 535 GAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 G P P P PPPP PP P P PP Sbjct: 118 GGYVPPPPPTGTLPPPPVTPPPGPE--TPPPPDTPAPP 153 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 508 GXPPXXPXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPP 648 G P P G PP P PPP PP P P PP Sbjct: 119 GYVPPPPPTGTLPPPPVT----PPPGPETPPPPDTPAPPVPPTEAPP 161 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +2 Query: 521 PXPXXGRXPP---TPXPXPXXPPPXPXXLXPXTXXXXPXXXXP 640 P P G PP TP P P PPP P P P Sbjct: 123 PPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 PP PPPP P PP P PP P Sbjct: 138 PPGPETPPPPDT----PAPPVPPTEAPPTAPP 165 Score = 26.6 bits (56), Expect(2) = 0.41 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXP 590 P PP P PP P PP P Sbjct: 141 PETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 24.2 bits (50), Expect(2) = 0.41 Identities = 11/24 (45%), Positives = 11/24 (45%), Gaps = 2/24 (8%) Frame = +3 Query: 387 PPPXX--PPPXXWXXPSFXXPPPP 452 PPP PPP P PPPP Sbjct: 124 PPPTGTLPPPPVTPPPGPETPPPP 147 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXS----XPPXPXP 620 P P G PPPP PPPP P PP P P Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 682 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +1 Query: 508 GXPPXXPXXG--AXPPHPXPXXXXPPPPXLXPP 600 G PP P G PP P P P PP PP Sbjct: 651 GIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +3 Query: 549 PPXPXXXX-PPPPXPXXSXPPXPXPXXXXXXPXP 647 PP P PPPP PP P P P P Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGP 677 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXS 599 P P PPPP P PPPP P S Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPPAS 887 Score = 32.7 bits (71), Expect = 0.27 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 P PP PPPP P PPPP P S P Sbjct: 864 PRRPPP---PPPPPPPPPPPPPPPPASSTGSTP 893 Score = 32.3 bits (70), Expect = 0.35 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 546 PPPXPXXXXPPPPXPXXSXPPXPXP 620 P P P PPPP P PP P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXP 614 P P P PPPP P PP P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGG 483 GG GGGG G G GG G GG GGG Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 32.3 bits (70), Expect = 0.35 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGG 542 G GCGG G GGGG G GGGG Sbjct: 81 GGGCGG---GGGGGGGVGGGGGGGGG 103 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 581 GGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GGG G G GG G GG GGGGGG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGG---GGGGGGGG 105 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGG 480 GG GGG G G GG G GG GGG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 607 GGXEXXGXGGGGXXXXGXGGGG 542 GG G GGGG G GGGG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGG 101 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 32.7 bits (71), Expect = 0.27 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 P PP PPP P PP P PP P P P Sbjct: 1243 PDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGP 1286 Score = 29.5 bits (63), Expect = 2.5 Identities = 20/73 (27%), Positives = 21/73 (28%) Frame = +3 Query: 402 PPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXXXXPPP 581 PPP + PPPP P P PPPP PP Sbjct: 1224 PPPMGHHMMNMP-PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPR----MQPP 1278 Query: 582 PXPXXSXPPXPXP 620 P PP P P Sbjct: 1279 GPPGPPGPPGPQP 1291 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 508 GXPPXXPXXGAXPPHPXPXXXXPPPPXLXPP 600 G PP P PP P PPPP + PP Sbjct: 1251 GLPPPPPGMRPMPPQP---PFMPPPPRMQPP 1278 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXP 560 PPP PP P F PPP P PP PP P P Sbjct: 1237 PPPAMPPD---GPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPP--XPXXSXPPXPXP 620 AP PP APPPP P PP P + PP P P Sbjct: 174 APAAPP---APPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 32.3 bits (70), Expect = 0.35 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 513 APXXPPXXGAPP-PPXPXXXXPPPPXPXXSXPP 608 AP PP GAP PP P PP P PP Sbjct: 177 APPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 32.7 bits (71), Expect = 0.27 Identities = 21/58 (36%), Positives = 22/58 (37%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGGV 474 GG G G GG GGG G G GG G GG GG GGG+ Sbjct: 146 GGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGG-----GMGGGMGGGMEGGMGGGM 198 Score = 27.9 bits (59), Expect = 7.6 Identities = 28/95 (29%), Positives = 29/95 (30%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXGGGG 440 G G GG G GGG G GGG+ G A GGG Sbjct: 141 GGGMGGGMSMGGMGGG--MGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGM 198 Query: 439 XXKXGXXQXXGGGXXGGGXXKKXGXXFXLXTXGGK 335 GGG GGG G F GGK Sbjct: 199 MEGMQGMGSMGGGMMGGGMG--GGMGFNGMEDGGK 231 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 32.7 bits (71), Expect = 0.27 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G GG GG G G G+GG G GG GG GG Sbjct: 184 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 31.9 bits (69), Expect = 0.47 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGG G G+GG + G GG GGG GG Sbjct: 183 GGGGSQGGGYRSGGGGYGG-SSRGGYGGGRGGGGYGGGRGG 222 Score = 28.7 bits (61), Expect = 4.4 Identities = 21/65 (32%), Positives = 23/65 (35%) Frame = -1 Query: 580 GGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXGGGGXXKXGXXQXXGGG 401 GGG G GGG GG G + GGGG G + GGG Sbjct: 183 GGG----GSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYG--GGRRDYGGG 236 Query: 400 XXGGG 386 GGG Sbjct: 237 SKGGG 241 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 32.3 bits (70), Expect = 0.35 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 596 GXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGG 480 G GGGG G G GG G G GGGGG Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGG 506 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGG 483 GG GGG G G GG G G GGGG Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGG 506 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 32.3 bits (70), Expect = 0.35 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXPXP 620 PPPP P PPPP P P P Sbjct: 425 PPPPPPAPLPPPPPPPPQPTTALPDP 450 Score = 31.1 bits (67), Expect = 0.82 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXP 614 PPPP P PPPP P PP P Sbjct: 424 PPPPPPPAPLPPPPPP----PPQP 443 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 32.3 bits (70), Expect = 0.35 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXP---XXSXPPXPXP 620 P PP PPPP PPPP P S P P P Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAP 818 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 32.3 bits (70), Expect = 0.35 Identities = 21/78 (26%), Positives = 24/78 (30%), Gaps = 2/78 (2%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPP--PXP 560 PPP PP P + PPP + PP APPP P Sbjct: 157 PPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGY---QQPPPGGYAPPPYVPQE 213 Query: 561 XXXXPPPPXPXXSXPPXP 614 PP P + P P Sbjct: 214 GGGIPPQNHPLTNYPAPP 231 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 32.3 bits (70), Expect = 0.35 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGG--GGGGVWVXXXKXXGG 444 GG GGG G G+GG + G GG GG GGGG + + GG Sbjct: 92 GGGGSQGGGYRSGGGGYGG-SSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGG 144 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 613 GCGGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 G GG G GGG G GGGG GG Sbjct: 322 GGGGGYGGGRGGGRGYGGGRGGGGRRDYGG 351 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 584 GGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGGVWVXXXKXXGGR 441 GGGG G GG GG GGG GG GGR Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGR 139 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 27.5 bits (58), Expect(2) = 0.37 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 1/39 (2%) Frame = +3 Query: 339 PPXVXXXNXXPXFXXXPPPXX-PPPXXWXXPSFXXPPPP 452 PP P PPP PPP P F PPP Sbjct: 461 PPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPP 499 Score = 23.4 bits (48), Expect(2) = 0.37 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPP 584 PP PPPP PPPP Sbjct: 491 PPFYRGPPPP---RGMPPPP 507 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 31.9 bits (69), Expect = 0.47 Identities = 27/102 (26%), Positives = 29/102 (28%), Gaps = 5/102 (4%) Frame = +3 Query: 324 PXAFFPPXVXXXNXXPXFXXXPPPXXPPPXXWXXPSFXXP-----PPPXFXXXXXXXXXX 488 P A PP V + PP PPP + PS P PPP Sbjct: 493 PVAAPPPSVFAPSSGVPTTVTAPPAAPPPSVFA-PSSGVPTPVTEPPPAPPPSVFAPSSG 551 Query: 489 XXXXXXXXAPXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 P PP AP P PPP P P Sbjct: 552 VPTPVTAPPPAPPPSVFAPSSAVPTPATAPPPVAATLSAPPP 593 Score = 31.5 bits (68), Expect = 0.62 Identities = 29/109 (26%), Positives = 31/109 (28%), Gaps = 10/109 (9%) Frame = +3 Query: 324 PXAFFPPXVXXXNXXPXFXXXPPPXXPPPXXWXXPS-----FXXPPPPXFXXXXXXXXXX 488 P A PP V + PP PPP + S PPP F Sbjct: 435 PVAAPPPSVFASSSGVPTPVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPV 494 Query: 489 XXXXXXXXAPXX--PPXXGAPPPPXPXXXXPPP---PXPXXSXPPXPXP 620 AP P APP P P P P PP P P Sbjct: 495 AAPPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPPP 543 Score = 28.7 bits (61), Expect = 4.4 Identities = 23/85 (27%), Positives = 24/85 (28%), Gaps = 5/85 (5%) Frame = +3 Query: 369 PXFXXXPPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXA--PXXPPXXGA 542 P PPP P P P PPP F A P A Sbjct: 340 PSSVVAPPPAVPTPAT-APPPVVAPPPSVFASSSGVPTPVKAPPPSVFASSSGVPTPVAA 398 Query: 543 PPPPXPXXXXPPP---PXPXXSXPP 608 PPP P P P P + PP Sbjct: 399 PPPAPPPSVFAPSSGVPTPVAAPPP 423 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 31.9 bits (69), Expect = 0.47 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 607 GGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 GG G GGGG G GGGG GG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 607 GGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 G G GGGG G GGGG GG Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXG 527 G G GG G GGGG GGGG G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 31.9 bits (69), Expect = 0.47 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGGVW 471 GG G GG G G G G G P G G GG W Sbjct: 6 GGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGW 48 Score = 30.7 bits (66), Expect = 1.1 Identities = 27/97 (27%), Positives = 30/97 (30%), Gaps = 3/97 (3%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXGGGG 440 G G GG G G GG G GGG GG G G G Sbjct: 2 GQGPGGW---GRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGR 58 Query: 439 XXKXGXXQXXGGG---XXGGGXXKKXGXXFXLXTXGG 338 G + GGG GGG + G + GG Sbjct: 59 GPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQEGG 95 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 31.5 bits (68), Expect = 0.62 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 P PP PP P PP P P + PP P P P Sbjct: 1020 PTDPPTEPPTDPPTPPPTEPPTPPP--TEPPTPPPTDPPTQP 1059 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 31.5 bits (68), Expect = 0.62 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 528 PXXGAPPPPXPXXXXPPPPXP 590 P PPPP P PPPP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLP 1327 Score = 31.5 bits (68), Expect = 0.62 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +3 Query: 540 APPPPXPXXXXPPPPXPXXSXPPXP 614 +PPPP P PPPP P PP P Sbjct: 1310 SPPPPPP----PPPPPPPPPLPPTP 1330 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPP 584 P PP PPPP P PP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 558 PXXXXPPPPXPXXSXPPXPXP 620 P PPPP P PP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLP 1327 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 31.5 bits (68), Expect = 0.62 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 AP PP P PP P P PP P PP P P P Sbjct: 750 APPLPPKV-TPKPPAPPQFAPVPP-PCAPIPPMPCSAPLPPAPAP 792 Score = 29.9 bits (64), Expect = 1.9 Identities = 22/76 (28%), Positives = 23/76 (30%), Gaps = 3/76 (3%) Frame = +3 Query: 390 PPXXP-PPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPP--PPXP 560 PP P PP P P PP F P P A P PP P Sbjct: 748 PPAPPLPPKVTPKP----PAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAP 803 Query: 561 XXXXPPPPXPXXSXPP 608 PPP P + P Sbjct: 804 NISAEPPPPPPVARKP 819 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 513 APXXPPXXGAPPPPXP-XXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 AP PP AP PP P PP P P + P P P P Sbjct: 768 APVPPPC--APIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPP 811 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPP-PPXPXXSXPPXPXP 620 P P PP P P P PP P S P P P Sbjct: 778 PPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPP 813 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 31.1 bits (67), Expect = 0.82 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 515 PXPXPXXGRXPPTPXPXPXXPPPXPXXLXP 604 P P P PPTP P P P P P P Sbjct: 1358 PRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXPXP 620 PPPP P PPP P P P Sbjct: 1578 PPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +3 Query: 540 APPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 +P P P P PP P P P P P P Sbjct: 1352 SPIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 31.1 bits (67), Expect = 0.82 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPP 584 PP PPPP P PPPP Sbjct: 64 PPTLPPPPPPPPPPLPPPPP 83 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXP 614 P P P PPPP P PP P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPP 82 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 31.1 bits (67), Expect = 0.82 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPP 584 PP PPPP P PPPP Sbjct: 288 PPTLPPPPPPPPPPLPPPPP 307 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPPXP 614 P P P PPPP P PP P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPP 306 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 31.1 bits (67), Expect = 0.82 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 526 PXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXPPQT 654 P G P HP P PPP + PP P PP T Sbjct: 423 PPGGGVPSHPPPLPQ--PPPSIIPPPTTPLPQTVPTPPRPPTT 463 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 A PP G P P P P PP P P P P P Sbjct: 419 AKGGPPGGGVPSHPPP---LPQPPPSIIPPPTTPLPQTVPTPPRP 460 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 31.1 bits (67), Expect = 0.82 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXGGGG 440 G G G G GGGG G GGG GG G K GG G Sbjct: 756 GGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGG----GHRGGSYSGYRGSYKSGGYG 811 Query: 439 XXKXGXXQXXGG 404 G Q GG Sbjct: 812 QGSGGYGQGSGG 823 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G GG GG G G+GG GG GGGG G Sbjct: 733 GGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYG 789 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 596 GXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G R GGG G G GG G G GG GGG Sbjct: 752 GNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGG 791 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 8/67 (11%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXG---GXRXGGGGXXXXGXGWG-----GXAPXXGXXGGXPXXXXG 492 GG G G W G G GGG G GWG G G G G Sbjct: 257 GGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMG 316 Query: 491 GGGGGVW 471 G GG W Sbjct: 317 RGPGGGW 323 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG G G W G GGG G GWG G G GGG G Sbjct: 281 GGGWGRGSGGGW-----GRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMG 332 Score = 28.7 bits (61), Expect = 4.4 Identities = 29/109 (26%), Positives = 31/109 (28%), Gaps = 6/109 (5%) Frame = -1 Query: 646 GXGXXXXXXGXGCG-GXEXXGXGGGGXXXXGXGGGGAPXXG-----GXXGAXXXXXXXXX 485 G G G G G G G G GG G GGG G G G Sbjct: 233 GRGSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGW 292 Query: 484 XXXXXXXXXKXGGGGXXKXGXXQXXGGGXXGGGXXKKXGXXFXLXTXGG 338 + GGG G Q G GGG + G GG Sbjct: 293 GRMQGGGMGRGPGGG---WGRMQGGMGRGPGGGWGRMQGGGMGRGPGGG 338 Score = 27.9 bits (59), Expect = 7.6 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = -3 Query: 647 GGXXXXGXGXXWXWXXGGX-RXGGGGXXXXGXGWGGXAPXXG---XXGGXPXXXXGGGGG 480 GG G G W GG R GGG G G P G GG GGG G Sbjct: 297 GGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMG 356 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 613 GCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G GG + G GGGG GGGG G G Sbjct: 182 GDGGDDGGGSGGGGDDGGSDGGGGGNDGGRDDG 214 Score = 29.1 bits (62), Expect = 3.3 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXX--GAXXXXXXXXXXXXXXXXXXKXGG 446 G G G + G G G G G GG GG G GG Sbjct: 131 GDGDGDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGG 190 Query: 445 -GGXXKXGXXQXXGGGXXGG 389 GG G GGG GG Sbjct: 191 SGGGGDDGGSDGGGGGNDGG 210 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 589 GXGGGGXXXXGXGGGGAPXXGGXXG 515 G GGGG G GGGG GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 589 GXGGGGXXXXGXGGGGAPXXGGXXG 515 G GGGG G GGGG GG G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 G G GG G GGGG G GGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -3 Query: 581 GGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GGG G G+GG P G GG GGGGGG Sbjct: 25 GGGGHGGGHGYGG-GPNGGGGGGG----GGGGGGG 54 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -1 Query: 619 GXGCGGXEXXGXG---GGGXXXXGXGGGGAPXXGGXXG 515 G G GG G G GGG G GGGG G G Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNG 63 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPP--PXPXXSXPPXPXPXXXXXXPXP 647 P PPPP PPP P + PP P P P P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPP 318 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +3 Query: 516 PXXPPXXGAP-PPPX---PXXXXPPPPXPXXSXPPXPXP 620 P PP G PPP P PPPP P P P P Sbjct: 281 PPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPP 319 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGGVWV 468 GG G GG G G G G GG GGGG V V Sbjct: 63 GGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGGFVVV 106 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGA 539 G G GG + G G G G GGGGA Sbjct: 66 GGGAGGDDDDGGGISGCGDGGGGGGGA 92 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/76 (25%), Positives = 19/76 (25%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 PPP PP P PP P P PP P Sbjct: 247 PPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLPNF 306 Query: 567 XXPPPPXPXXSXPPXP 614 P PP P P P Sbjct: 307 TSPSPPPPPPLPPAMP 322 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/73 (26%), Positives = 21/73 (28%) Frame = +3 Query: 402 PPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXXXXPPP 581 PPP P+ PP AP P PPP P P Sbjct: 245 PPPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPM---TPPPAVVTAPPPAP 301 Query: 582 PXPXXSXPPXPXP 620 P P + P P P Sbjct: 302 PLPNFTSPSPPPP 314 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 28.3 bits (60), Expect(2) = 1.1 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 613 GCGGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 G GG G GGGG G GGGG GG Sbjct: 198 GRGGYGGRGRGGGGRGGYG-GGGGYGGYGG 226 Score = 21.0 bits (42), Expect(2) = 1.1 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = -1 Query: 451 GGGGXXKXGXXQXXGGGXXGGG 386 GGG G Q GGG G G Sbjct: 218 GGGYGGYGGYDQYSGGGYGGYG 239 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 514 PPXXPXXGAXPPHPXPXXXXPPPPXLXPP 600 PP P PPH P PPP PP Sbjct: 275 PPGFPPRWGPPPHMPPDYRGFPPPNFPPP 303 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPP 584 P PP +PPPP P PPP Sbjct: 363 PTPPPPPHSPPPPLPVIQLNPPP 385 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 543 PPPPXPXXXXPPPPXPXXSXPP 608 PPPP P P PP P PP Sbjct: 85 PPPPPPASNVPAPPPPPPVMPP 106 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 559 PXXXXPPPPXLXPPXXHXXXXPXPXXXXPPQ 651 P PPPP PP + P P PPQ Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPPQ 107 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 30.3 bits (65), Expect = 1.4 Identities = 23/91 (25%), Positives = 25/91 (27%), Gaps = 2/91 (2%) Frame = +3 Query: 324 PXAFFPPXVXXXNXXPXFXXXPPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXX 503 P A PP + + PP PP P PPPP Sbjct: 686 PPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLGRDSAAVFMLTWTPL 745 Query: 504 XXX--APXXPPXXGAPPPPXPXXXXPPPPXP 590 A PP P P PPPP P Sbjct: 746 TNTSSAANVPPPPPPPAVPGEGARPPPPPPP 776 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 30.3 bits (65), Expect = 1.4 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = -1 Query: 613 GCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXGGGGXX 434 G G G GGG G GGG P G G GG Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGD 384 Query: 433 KXGXXQXXGGGXXGGG 386 G GGG GGG Sbjct: 385 HGGGDH--GGGDHGGG 398 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 29.9 bits (64), Expect = 1.9 Identities = 25/90 (27%), Positives = 25/90 (27%), Gaps = 3/90 (3%) Frame = +3 Query: 387 PPPXXPPPXXWXXPSFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXGAPPPPXPXX 566 PPP P P P PPPP P P P PP P Sbjct: 685 PPPPLPTPIASSEPLPLPPPPP---------------PTGIDIPHSPSKDDLPLPPPPEE 729 Query: 567 XXPPPP---XPXXSXPPXPXPXXXXXXPXP 647 PPP P PP P P P Sbjct: 730 VSLPPPDESPPSSKHPPTVSPSSSSAPPRP 759 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 29.9 bits (64), Expect = 1.9 Identities = 23/86 (26%), Positives = 23/86 (26%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXX 467 G G G GG G G G GGG GG GA Sbjct: 109 GGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGA----QAGGSTSGSSS 164 Query: 466 XXXKXGGGGXXKXGXXQXXGGGXXGG 389 GGGG GGG G Sbjct: 165 GGATSGGGGVSGSSGTSIAGGGSSAG 190 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 29.9 bits (64), Expect = 1.9 Identities = 23/87 (26%), Positives = 24/87 (27%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXX 467 G G G G GG + G G G G G G G G Sbjct: 252 GDGDGDGDGGGGGGGGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDG 311 Query: 466 XXXKXGGGGXXKXGXXQXXGGGXXGGG 386 G G G GGG GGG Sbjct: 312 DGDGDGDGDGD--GDGDGDGGGGDGGG 336 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPP 581 P P G PPPP P PPP Sbjct: 351 PKTHPQLGPPPPPPPPPPTPPP 372 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXGA 512 G G G GG G G G G GGG G GA Sbjct: 425 GGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGA 469 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGG 480 GG G GG G G G + G G G GGG Sbjct: 425 GGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGG 464 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G G GGGG G GGG GG G Sbjct: 347 GPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSG 381 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGG 480 GG GGGG G GG G G GGGGG Sbjct: 354 GGFGGGGGGSEDNGAS-GGGGGYSGGGSGITWNQAGGGGG 392 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 540 APPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXP 647 APPPP P PP P P P P P Sbjct: 1661 APPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGP 1696 >SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) Length = 1850 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 546 PPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXP 641 PPP P PPP P P P P P Sbjct: 1454 PPPDPAERRVPPPFPAERRTPAPDPAERRVPP 1485 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 29.5 bits (63), Expect = 2.5 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 2/70 (2%) Frame = -1 Query: 589 GXGGGGXXXXGXGGGGAPXXGGXXGAXXXXXXXXXXXXXXXXXXKXGGGGXXKX--GXXQ 416 G GGGG G G GG G GGGG G Sbjct: 216 GGGGGGFYTDGQGSRNKGGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGA 275 Query: 415 XXGGGXXGGG 386 GGG GGG Sbjct: 276 GGGGGYSGGG 285 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXG-WGGXAPXXGXXGGXPXXXXGGGGGG 477 G R G GG G G GG G GG GG GGG Sbjct: 439 GDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGG 480 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G G G GG G GGG G GGG GG G Sbjct: 437 GVGDGRGGDGGGDGGG--GGDGGGDGIDGGDGGGDGGGDGGGDG 478 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 596 GXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G GGGG G G G G GG GG GGG Sbjct: 446 GGGDGGGGGDGGGDGIDG-GDGGGDGGGDGGGDGGGDGGG 484 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 GG GGGG G G G G GG GGG GG Sbjct: 446 GGGDGGGGG---DGGGDGIDGGDGGGDGGGDGGGDGGGDGG 483 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 +P PP PP P PP P + PP P Sbjct: 44 SPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 P P PP P P P P + P P P Sbjct: 14 PVDQATPKPPQPTPPKPDTPPPGTNIPTPPSP 45 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 513 APXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXP 614 +P PP PPP PPP P P P Sbjct: 510 SPPPPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G G GGGG G GGG GG G Sbjct: 217 GPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSG 251 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGG 483 GG GGGG G GG G G GGGG Sbjct: 224 GGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGG 262 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G GG E G GGG G G G G G Sbjct: 227 GGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGG 261 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 528 PXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 P G PPP P P P P P P P Sbjct: 587 PQPGTYPPPHPSGGYPQPSPPHGGHPHHPPP 617 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G G GG GG G G GG GG G Sbjct: 793 GAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASG 836 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -1 Query: 646 GXGXXXXXXGXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G G GG GG G G GG GG G Sbjct: 771 GAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASG 814 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G GG + G GGG G GGG G G Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 132 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G GG + G GGG G GGG G G Sbjct: 108 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 142 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -3 Query: 644 GXXXXGXGXXWXWXXGGXRXGGGGXXXXGXGWGGXAPXXGXXGGXPXXXXGGGGGG 477 G G G GG GG G G G G GG GGGGG Sbjct: 165 GGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGGGGG 220 >SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) Length = 491 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -1 Query: 613 GCGGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 G GG + G GGG GGGG GG Sbjct: 347 GGGGIQSFGGGGGADLQTLGGGGGVQTLGG 376 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -3 Query: 596 GXRXGGGGXXXXGXGWGGXAPXX-GXXGGXPXXXXGGGGGGV 474 G + GGG G GG A G G P GGGG G+ Sbjct: 381 GVQSYGGGAGMQSFGGGGMAGMQFGGMQGFPSLGGGGGGAGM 422 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPP--XPXXSXPP 608 PP G PPP PPPP P PP Sbjct: 53 PPAGGYPPPQPGYAGGPPPPGIAPGIGGPP 82 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 28.7 bits (61), Expect = 4.4 Identities = 26/103 (25%), Positives = 27/103 (26%), Gaps = 14/103 (13%) Frame = +3 Query: 387 PPPXXPPPXXWXXP------SFXXPPPPXFXXXXXXXXXXXXXXXXXXAPXXPPXXG--- 539 PPP PPP + P P P AP P Sbjct: 458 PPPPPPPPQMYQQPLMMPQAPMMMPQAPMMMPQAPMTMQQQAQMQQPCAPSCAPTYSPSC 517 Query: 540 -----APPPPXPXXXXPPPPXPXXSXPPXPXPXXXXXXPXPXN 653 AP PP P PP P P PP P P N Sbjct: 518 CGSYPAPQPPSPPAP-PPKPAPPPRSPPAAAPCNPAMAPQGCN 559 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 P P GAPP P P P + PP P P Sbjct: 858 PLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 >SB_15859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 970 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 516 PXXPPXXGAPPPPXPXXXXPPPPXP 590 P PP PPPP PPP P Sbjct: 744 PAAPPGIYLPPPPAATAATPPPSSP 768 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 G G GG + G GGG G G GG GG G Sbjct: 158 GGGDGGDD--GDGGGDDDDGGDGDGGGDDGGGADG 190 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 28.3 bits (60), Expect = 5.8 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 599 GGXRXGGGGXXXXGXGWGGXA--PXXG-XXGGXPXXXXG--GGGGGVW 471 GG GGGG G+GG P G G G GGG GVW Sbjct: 1269 GGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPRGGGSGVW 1316 >SB_19554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 540 APPPPXPXXXXPPPPXPXXSXPPXP 614 AP PP P PPPP P PP P Sbjct: 107 APFPPKPTVATPPPPLP----PPMP 127 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = +3 Query: 516 PXXPPXX-GAPPPPXPXXXXPP 578 P PP GAPPPP P PP Sbjct: 125 PRAPPGGPGAPPPPPPPAVVPP 146 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +2 Query: 521 PXPXXGRXPPTPXPXPXXPPPXPXXL--XPXTXXXXPXXXXPXPXKP 655 P P P T P P PP P + P + P P P KP Sbjct: 146 PNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKP 192 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPPXPXP 620 PP G+ P P P PP P S P P P Sbjct: 172 PPQPGSEEPE-PVSQAPEPPKPKTSAPEPPKP 202 >SB_9261| Best HMM Match : Chitin_synth_2 (HMM E-Value=2.7e-07) Length = 2435 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 526 PXXGAXPPHPXPXXXXPPPPXLXPPXXHXXXXPXPXXXXP 645 P G PP P PPP PP P P P Sbjct: 118 PPQGYIPPQPPYPWRQPPPEAYIPPDHGMLGIPIPLRRPP 157 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 539 RXPPTPXPXPXXPPPXPXXLXPXT 610 R PP P P P PPP P T Sbjct: 140 RNPPPPPPPPSPPPPCHPPALPST 163 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 589 GXGGGGXXXXGXGGGGAPXXGGXXG 515 G GGG G GG G P GG G Sbjct: 424 GGPGGGYEGRGRGGRGGPRGGGPRG 448 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 525 PPXXGAPPPPXPXXXXPPPPXPXXSXPP 608 P G PP P PPPP + PP Sbjct: 888 PGLPGTPPITSPSSLPPPPPLQGYNPPP 915 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 619 GXGCGGXEXXGXGGGGXXXXGXGGGGAPXXGG 524 G G G G GGGG GGG GG Sbjct: 329 GSGGSGTSEGGFGGGGATVASRPGGGGGYSGG 360 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 607 GGXEXXGXGGGGXXXXGXGGGGAPXXGGXXG 515 GG G GGGG GGG GG G Sbjct: 53 GGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 580 GGGXXXXGXGGGGAPXXGGXXGA 512 GGG G GGGG GG GA Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGGA 1025 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 545 PPTPXPXPXXPPPXPXXL 598 PP P P P PPP P L Sbjct: 163 PPQPPPPPLPPPPPPIDL 180 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,635,854 Number of Sequences: 59808 Number of extensions: 314066 Number of successful extensions: 7946 Number of sequences better than 10.0: 140 Number of HSP's better than 10.0 without gapping: 806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3344 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -