BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_E15 (869 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0062 - 476027-476044,476791-477195,477287-477574,477653-47... 31 1.6 03_02_1012 + 13207907-13207990,13209196-13209280,13209402-132101... 29 6.4 02_02_0138 + 7114949-7115656,7116388-7116435,7116830-7117988,711... 28 8.5 >11_01_0062 - 476027-476044,476791-477195,477287-477574,477653-477830, 478005-478133,478531-478729,478832-478970,479130-479195, 480459-480580,480672-480742,480819-480903,481335-481453, 481577-481687,481945-482117,482375-482446,482768-482862, 483361-483450,483550-483646 Length = 818 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +3 Query: 222 VISNAEKSDGKIYTIHA--DINDNRIEKGVYEVDLNLNTTVKILDKGRDLCYDDD 380 +IS A+ D +Y I+ +++D+ +G L +D G D+CYDDD Sbjct: 245 IISLAQSEDSDVYDIYTVKEVDDDTTMEGTSSAPYPLLQ----VDNGDDVCYDDD 295 >03_02_1012 + 13207907-13207990,13209196-13209280,13209402-13210186, 13210262-13210462,13210580-13210690,13211105-13211487, 13211594-13211702,13211786-13211866,13212088-13212156, 13212379-13212467,13212619-13212780,13212859-13212916, 13213143-13213373,13213516-13213662,13213779-13214333, 13214562-13214819,13215096-13215203,13215760-13215854, 13215946-13216102,13216466-13216666,13217542-13217670, 13218292-13218567 Length = 1457 Score = 28.7 bits (61), Expect = 6.4 Identities = 20/58 (34%), Positives = 24/58 (41%) Frame = +3 Query: 429 GDKSFKKYGTFKADVISLTKMNGSDLFYAVTNDNKAYKVTENGNKYVLDDNLKAVKQV 602 G KS YG F V SL D Y DN +YK+ E +K L NL + Sbjct: 169 GTKSTNAYGGFNKVVASL------DSSYLDMGDNVSYKIPEGYDKLALSLNLPVFSDI 220 >02_02_0138 + 7114949-7115656,7116388-7116435,7116830-7117988, 7118336-7118424,7118697-7118732 Length = 679 Score = 28.3 bits (60), Expect = 8.5 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +3 Query: 531 KAYKVTENGNKYVLDDNLKAVKQVMFDNFN-VLHYVTLDNEVFKVKETLEK 680 K YK+ +LD KA ++MFDN V H L ++ F+V E +++ Sbjct: 215 KGYKLDIFAYNMLLDALAKAGMKIMFDNREWVFHMYMLVDQAFQVFEDMKQ 265 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,578,676 Number of Sequences: 37544 Number of extensions: 332883 Number of successful extensions: 800 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 800 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2444475072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -