BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_E15 (869 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8817| Best HMM Match : I-set (HMM E-Value=0) 31 0.93 SB_57508| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) 31 1.6 SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) 30 2.1 SB_6780| Best HMM Match : DM4_12 (HMM E-Value=5.3) 29 3.7 SB_46013| Best HMM Match : DUF1129 (HMM E-Value=0.23) 29 4.9 SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_20883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_23808| Best HMM Match : zf-AN1 (HMM E-Value=5.5) 28 8.6 >SB_8817| Best HMM Match : I-set (HMM E-Value=0) Length = 2526 Score = 31.5 bits (68), Expect = 0.93 Identities = 28/111 (25%), Positives = 48/111 (43%), Gaps = 2/111 (1%) Frame = +3 Query: 372 DDDSTIYVASNDGIYVYKTGDKSFKKYGTFKADVISLTKMNGSDLFYAVTND-NKAYKVT 548 +DD I +DGI V + D G +K V S + + + KA K+ Sbjct: 331 EDDRVIISEQDDGIVVLRIKDVGAHDSGVYKCQVSSDVGTSTKSFDVTIEGERRKAKKLI 390 Query: 549 ENGNKYVLDDNLKAVKQ-VMFDNFNVLHYVTLDNEVFKVKETLEKIDLMLK 698 E L+ +K VK+ V + ++ +V K ++ +E++D MLK Sbjct: 391 EVDETEHLEKRIKHVKEPVPEEQVMPTKVKPVETKVDKPRQ-IEEVDAMLK 440 >SB_57508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1215 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/76 (22%), Positives = 34/76 (44%) Frame = +3 Query: 453 GTFKADVISLTKMNGSDLFYAVTNDNKAYKVTENGNKYVLDDNLKAVKQVMFDNFNVLHY 632 G K +++L K++G ++ +TNDN + + L D A+ ++ +N Sbjct: 572 GKLKDVLVTLMKVSGEEIVKVLTNDNNDDDGDDGNDSDFLTDTFDALFAILNENARKYDK 631 Query: 633 VTLDNEVFKVKETLEK 680 + D VF + +K Sbjct: 632 LVFDALVFTISLLADK 647 >SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) Length = 1776 Score = 30.7 bits (66), Expect = 1.6 Identities = 25/113 (22%), Positives = 43/113 (38%), Gaps = 2/113 (1%) Frame = +3 Query: 321 NLNTTVKILDKGRDLCYDDDSTIYVASNDGIYVYKTGD--KSFKKYGTFKADVISLTKMN 494 N N K + Y++++ +ND Y Y + K +K + + K Sbjct: 746 NNNNKCKDTNNDNKYKYNNNNECKDTNNDNKYKYNNNNECKDTNNGNKYKYNNNNECKDT 805 Query: 495 GSDLFYAVTNDNKAYKVTENGNKYVLDDNLKAVKQVMFDNFNVLHYVTLDNEV 653 +D Y N+NK K T N NKY ++ K V+H + ++ Sbjct: 806 NNDNKYKYNNNNKC-KDTNNDNKYKHNNKYKVKNSKKMMGAGVVHPANITKDI 857 >SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) Length = 1291 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = -1 Query: 662 HFKYFIIQSDIVQYIEVIKHNLFDGFQIIIQNVFVTIFSDFVSFIVV 522 HF Y +++ Y V++H+ F ++++ + F+T+FS + FI V Sbjct: 1077 HFHYRVLRHHPFHY-RVLRHHPFH-YRVLRHHPFITVFSVIILFITV 1121 >SB_6780| Best HMM Match : DM4_12 (HMM E-Value=5.3) Length = 160 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/73 (24%), Positives = 30/73 (41%) Frame = +3 Query: 480 LTKMNGSDLFYAVTNDNKAYKVTENGNKYVLDDNLKAVKQVMFDNFNVLHYVTLDNEVFK 659 LTK+ S+ F + K Y + V +D ++ K+ +F + V L E F Sbjct: 26 LTKVGHSNCFSLLVTSRKVYGAPGEVRQAVFEDVVRVCKEAELFSFEQVKAVHLHPEAFS 85 Query: 660 VKETLEKIDLMLK 698 V+ L +K Sbjct: 86 VENDLMTATFKIK 98 >SB_46013| Best HMM Match : DUF1129 (HMM E-Value=0.23) Length = 553 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = +3 Query: 243 SDGKIYTIHADINDNRIEKGVYEVDLNLNTTVKILDKGRDLCYDDDSTIYVASNDGIY 416 +D I INDN + +Y+ D ++N ++ + D+D++IY N IY Sbjct: 287 NDNSINDNDNSINDN--DNSIYDNDNSINDNDNSINDNDNSINDNDNSIYDNDNSSIY 342 >SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5834 Score = 29.1 bits (62), Expect = 4.9 Identities = 29/104 (27%), Positives = 44/104 (42%), Gaps = 4/104 (3%) Frame = +3 Query: 147 VLNGSVFRQRSVELYSTEDQVVGAFVISNAEKSDGKIYTIH----ADINDNRIEKGVYEV 314 V+N V +S+ +YS +D + + + S G YT+H A I I K Sbjct: 3880 VVNLRVRSCKSLFVYSYKD------IKEHRDSSGG--YTLHFNRTATITSTFITKAFTSE 3931 Query: 315 DLNLNTTVKILDKGRDLCYDDDSTIYVASNDGIYVYKTGDKSFK 446 ++ KI G L Y ST Y+ S G++ GD F+ Sbjct: 3932 YNTIDLMFKIERHGVILSYSKQSTFYLTSIGGVFTLHFGDNVFR 3975 >SB_20883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 672 Score = 28.7 bits (61), Expect = 6.5 Identities = 28/110 (25%), Positives = 49/110 (44%), Gaps = 7/110 (6%) Frame = +3 Query: 261 TIHADINDNRIEKGVYEVDLNLN------TTVKILDKGRDLCYDDDSTIYVASNDGIYV- 419 T + D + R+EKG +V ++ T + +L+ G + + + S I V Sbjct: 292 TNYTDTSSLRLEKGEAQVKKGVSIAGLGETELTLLEDGENAESETKESKISRSPISISVP 351 Query: 420 YKTGDKSFKKYGTFKADVISLTKMNGSDLFYAVTNDNKAYKVTENGNKYV 569 K GD+ K Y +V+ N S+ Y+V N +K + E GN ++ Sbjct: 352 VKVGDEKTKGY---VYNVLKKEISNNSESDYSVINRSKTIPLLEKGNLHI 398 >SB_23808| Best HMM Match : zf-AN1 (HMM E-Value=5.5) Length = 165 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -2 Query: 256 ILPSLFSALDITKAPTT*SSVEYSSTLRCLKTEPLSTLEA 137 ILPS A+ +TKA T +E RC++ E + EA Sbjct: 122 ILPSSVDAVRLTKASTKLRDIELKDIERCIEVEDTAFGEA 161 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,390,621 Number of Sequences: 59808 Number of extensions: 420716 Number of successful extensions: 1189 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1170 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2491217872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -