SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP04_F_E15
         (869 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK025577-1|BAB15176.1|  724|Homo sapiens protein ( Homo sapiens ...    32   3.1  

>AK025577-1|BAB15176.1|  724|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21924 fis, clone HEP04086. ).
          Length = 724

 Score = 31.9 bits (69), Expect = 3.1
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = -1

Query: 677 FQSLFHFKY--FIIQSDIVQYIEVIKHNLFDGFQIIIQNVFVTIFSDFVSFIVVC 519
           + SL H+KY  ++I  D V    ++K N+F   +  +  VF ++    V ++ VC
Sbjct: 637 YHSLHHYKYHVYLICKDEVLSSHLLKKNVFQNVKETLAIVFWSVLKRVVKYMCVC 691


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 102,061,795
Number of Sequences: 237096
Number of extensions: 1858046
Number of successful extensions: 7428
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7306
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7423
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11048563978
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -