BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_E14 (855 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1727 + 29068348-29068571,29069473-29069514,29069593-290698... 28 8.3 03_02_0726 + 10722759-10722857,10722969-10723058,10723141-107232... 28 8.3 >07_03_1727 + 29068348-29068571,29069473-29069514,29069593-29069839, 29069936-29070013,29070551-29070736,29070829-29071126, 29071775-29072244 Length = 514 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +3 Query: 180 RRGQRCSRAQVEALQEN*ESGTQRSRWINQSGSSYSRHRA 299 +RG++ +RA+ EA +E GT+R+R + + + HRA Sbjct: 384 KRGEQMARAR-EAAREITPEGTERARVVGEEEAGPEHHRA 422 >03_02_0726 + 10722759-10722857,10722969-10723058,10723141-10723245, 10723597-10723698,10724721-10724805,10725281-10725365, 10725473-10725517,10725685-10728672,10728839-10729055, 10729193-10729765 Length = 1462 Score = 28.3 bits (60), Expect = 8.3 Identities = 28/85 (32%), Positives = 40/85 (47%) Frame = -2 Query: 299 CPMTAIAGPALINPSRTLRPTFSIFLKSFHLGSGAALTAPRASTNAKTKLKIRTKFILPK 120 C A AG + IN + T +I LKS G+ A+L + N K+ LK K +LP+ Sbjct: 428 CTPDAAAGQSTINDNVTNN---NIGLKS---GNNASL-----NINNKSSLKPLEKSVLPE 476 Query: 119 XYSAGEFKIPIQXRSTRTLRMSKSL 45 YSA P+Q +R S+ Sbjct: 477 QYSANRIG-PLQGADGSMMRSDSSI 500 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,052,535 Number of Sequences: 37544 Number of extensions: 217985 Number of successful extensions: 442 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 442 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2385713652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -