BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_E07 (870 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68879-4|CAA93085.1| 215|Caenorhabditis elegans Hypothetical pr... 34 0.11 Z29115-6|CAA82365.2| 1374|Caenorhabditis elegans Hypothetical pr... 29 4.3 Z19153-7|CAA79550.2| 1374|Caenorhabditis elegans Hypothetical pr... 29 4.3 >Z68879-4|CAA93085.1| 215|Caenorhabditis elegans Hypothetical protein K08F4.5 protein. Length = 215 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/64 (28%), Positives = 28/64 (43%) Frame = +3 Query: 396 TRRMNPTAPMLDYSEEPRNSCPRTG*TIATXTKNLVDAKEEEKRRLTKEWKNQFEGQSRY 575 T M+P P+++ EEP+ P +AKEE+K KE K + + Sbjct: 56 TANMHPAEPVVEKKEEPKEKVPEKKEEEKKDATKKEEAKEEKKEEERKEEKKEESKEGEK 115 Query: 576 RESG 587 + SG Sbjct: 116 KNSG 119 >Z29115-6|CAA82365.2| 1374|Caenorhabditis elegans Hypothetical protein C38C10.5b protein. Length = 1374 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 352 LHEIXNRCPHRRRGEPGE*TRQHPCWTTPKNH 447 + ++ + PHRR GEP + T + W NH Sbjct: 638 VRDVPHGLPHRRDGEPKDRTSKDATWLQELNH 669 >Z19153-7|CAA79550.2| 1374|Caenorhabditis elegans Hypothetical protein C38C10.5b protein. Length = 1374 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 352 LHEIXNRCPHRRRGEPGE*TRQHPCWTTPKNH 447 + ++ + PHRR GEP + T + W NH Sbjct: 638 VRDVPHGLPHRRDGEPKDRTSKDATWLQELNH 669 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,215,613 Number of Sequences: 27780 Number of extensions: 164881 Number of successful extensions: 411 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 411 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2181923744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -