BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_E06 (865 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 23 4.1 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 7.1 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -1 Query: 241 FNFFPQFLNCFLRTLSQRIYAIVFFRSIS 155 F P+ + +T Q+ YA+ FF ++S Sbjct: 16 FALTPRSIKLEKQTFIQKFYAVAFFLALS 44 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.8 bits (44), Expect = 7.1 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -1 Query: 322 LQIFIKFVEAVYHRAKVFLNSLRGQGGFNFFPQFLNCFLRTL 197 L IF +E V FL ++ GQG FN N L T+ Sbjct: 247 LVIFDCCLETVSALNGAFLYTINGQGQFNIEMFLCNMSLLTV 288 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,991 Number of Sequences: 336 Number of extensions: 2531 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -