BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_E06 (865 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0679 + 24230740-24230929,24231330-24231461,24231710-242319... 29 4.8 03_05_0825 - 27986393-27986767,27987541-27987625,27987936-279880... 28 8.4 >01_05_0679 + 24230740-24230929,24231330-24231461,24231710-24231977, 24232170-24232388,24233538-24233673,24233899-24234147, 24234783-24235100 Length = 503 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +2 Query: 182 INTLAESAKKTIEELR--EKVESALAPETVKKNFGTMVDSFNEFYKNLKPAE 331 ++ E A+K E L+ +K +L PE +K+ F +++ +F +F L+P E Sbjct: 254 VHATLEEARKFNEALQRWDKNAVSLVPEGLKRFFLSIMSNFRDFEDELEPHE 305 >03_05_0825 - 27986393-27986767,27987541-27987625,27987936-27988036, 27988144-27988227,27988868-27988939,27989203-27989319, 27989386-27989526,27989951-27990122,27990324-27990372, 27990773-27990821,27991240-27991270,27991301-27991371 Length = 448 Score = 28.3 bits (60), Expect = 8.4 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +2 Query: 164 PKEDNSINTLAESAKKTIEELREKVE 241 PKE ++ T+A + +KT EE+R +++ Sbjct: 91 PKESSTATTMAAATEKTAEEIRRELQ 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,634,985 Number of Sequences: 37544 Number of extensions: 268530 Number of successful extensions: 511 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 511 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2420970504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -