BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_E05 (873 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ606308-1|CAE54436.1| 4262|Homo sapiens secreted mucin MUC17 pr... 35 0.33 AJ606307-1|CAE54435.1| 4493|Homo sapiens membrane mucin MUC17 pr... 35 0.33 BC085017-1|AAH85017.1| 561|Homo sapiens LAMA5 protein protein. 34 0.77 AL354836-6|CAI12295.1| 500|Homo sapiens laminin, alpha 5 protein. 32 3.1 >AJ606308-1|CAE54436.1| 4262|Homo sapiens secreted mucin MUC17 protein. Length = 4262 Score = 35.1 bits (77), Expect = 0.33 Identities = 29/115 (25%), Positives = 51/115 (44%), Gaps = 1/115 (0%) Frame = +3 Query: 183 GSSMLSPLPITTRLFL*FCCSRNNRVEASSRIPSTISSETAIGMF*SSPTNCGSGRVRKS 362 GS+ L+ +P++TRL + S + A S T SSE + + T+ + + Sbjct: 568 GSTPLTNMPVSTRLVVSSEASTTSTTPADSNTFVTTSSEASSSSTTAEGTSMPTSTYSER 627 Query: 363 SNTTSLFSLDRCYPRATSRSSTRETILPSNS-VLRQTQITTESHTAMPTTRAART 524 T + S+ ++ S+ T + SN+ V T+ T+ S TA T+ T Sbjct: 628 GTTITSMSVSTTLVASSEASTLSTTPVDSNTPVTTSTEATSSSTTAEGTSMPTST 682 >AJ606307-1|CAE54435.1| 4493|Homo sapiens membrane mucin MUC17 protein. Length = 4493 Score = 35.1 bits (77), Expect = 0.33 Identities = 29/115 (25%), Positives = 51/115 (44%), Gaps = 1/115 (0%) Frame = +3 Query: 183 GSSMLSPLPITTRLFL*FCCSRNNRVEASSRIPSTISSETAIGMF*SSPTNCGSGRVRKS 362 GS+ L+ +P++TRL + S + A S T SSE + + T+ + + Sbjct: 568 GSTPLTNMPVSTRLVVSSEASTTSTTPADSNTFVTTSSEASSSSTTAEGTSMPTSTYSER 627 Query: 363 SNTTSLFSLDRCYPRATSRSSTRETILPSNS-VLRQTQITTESHTAMPTTRAART 524 T + S+ ++ S+ T + SN+ V T+ T+ S TA T+ T Sbjct: 628 GTTITSMSVSTTLVASSEASTLSTTPVDSNTPVTTSTEATSSSTTAEGTSMPTST 682 >BC085017-1|AAH85017.1| 561|Homo sapiens LAMA5 protein protein. Length = 561 Score = 33.9 bits (74), Expect = 0.77 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +3 Query: 396 CYPRATSRSSTRETILPSNSVLRQTQITTESHTAMPTTRAARTSA 530 CYP +S + TRE +LP+ ++ + +A+ +R TSA Sbjct: 471 CYPTPSSSNDTREQVLPAGQIVSGVSLCRPGWSAVARSRLTSTSA 515 >AL354836-6|CAI12295.1| 500|Homo sapiens laminin, alpha 5 protein. Length = 500 Score = 31.9 bits (69), Expect = 3.1 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 396 CYPRATSRSSTRETILPSNSVLRQTQIT 479 CYP +S + TRE +LP+ ++ T+I+ Sbjct: 471 CYPTPSSSNDTREQVLPAGQIVTNTKIS 498 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,120,590 Number of Sequences: 237096 Number of extensions: 2027570 Number of successful extensions: 5027 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5027 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11104084400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -