BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D20 (880 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0153 - 22766805-22767023,22767662-22767940,22768294-227684... 31 1.2 >05_05_0153 - 22766805-22767023,22767662-22767940,22768294-22768401, 22768500-22768779,22768871-22769174,22769367-22769975, 22770186-22770411 Length = 674 Score = 31.1 bits (67), Expect = 1.2 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 6/81 (7%) Frame = -1 Query: 304 IKRIGLIVQEKSVSVHYSHTVGILHCD--PLDDLITQY----LDVIGLLSAH**GDILSY 143 ++RI I ++ ++ Y H + I+HCD P + L+ Y + VI L S+ D LS Sbjct: 505 LRRIQAIARQCLEALVYLHHLNIVHCDLKPENILMKSYSRCEIKVIDLGSSCFLTDNLSL 564 Query: 142 FIDFI*YGGPIRTTTTPYDEK 80 ++ Y P PYD+K Sbjct: 565 YVQSRSYRAPEVILGLPYDQK 585 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,365,039 Number of Sequences: 37544 Number of extensions: 267140 Number of successful extensions: 509 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2479731924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -