BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D18 (908 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7)... 29 3.2 At1g64900.1 68414.m07357 cytochrome P450, putative similar to cy... 29 5.6 >At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7) identical to heat shock protein 70 [Arabidopsis thaliana] GI:6746592 Length = 718 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +1 Query: 454 VEHLGQAVAVCGQTEQLLSVLQQTMPAPIFHLLLKKLPEVSERLRS 591 ++ QA +V QTE+ L L + +P P+ + KL E+ E++ S Sbjct: 604 IDTKNQADSVVYQTEKQLKELGEKIPGPVKEKVEAKLQELKEKIAS 649 >At1g64900.1 68414.m07357 cytochrome P450, putative similar to cytochrome p450 GI:438240 from [Solanum melongena] Length = 506 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = +1 Query: 553 LKKLPEVSERLRSSMKA----RSNVMQEEDVE*KIVYLK 657 L K PE+ ERL +K+ + ++EEDVE K+ YLK Sbjct: 322 LVKYPEIQERLHEEIKSVVGEEAKEVEEEDVE-KMPYLK 359 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,888,089 Number of Sequences: 28952 Number of extensions: 281147 Number of successful extensions: 787 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 787 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2149324008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -