BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D17 (911 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0280 - 16729000-16729678,16729948-16730039,16730072-167307... 29 5.1 09_04_0625 - 19044775-19045078,19045178-19045382,19045534-190461... 29 5.1 >12_02_0280 - 16729000-16729678,16729948-16730039,16730072-16730772, 16731033-16731144,16731961-16731970,16732954-16733663 Length = 767 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +2 Query: 149 YTSSHPRLIEKDHLSVDFPVCSRDCWGAVPSKDTRPLNKPVP 274 YT P+L EK L+ DF C + C GA+P T L+ P Sbjct: 652 YTHRFPKL-EKFILACDFLPCLKFCIGAMPQLQTLKLDDRRP 692 >09_04_0625 - 19044775-19045078,19045178-19045382,19045534-19046168, 19046334-19047391 Length = 733 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -1 Query: 572 SRGQKLFCRSQLLSWRRLDPPISNQANADAQFIGWSSMNTYDVPPAAFGTP 420 S L CR L +W R+D P + + D +F+ +++ + P A+ P Sbjct: 658 SEEPSLLCRDDL-NWERIDAPFAEPTSEDEEFV---AIDDEEAPTASLSWP 704 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,893,836 Number of Sequences: 37544 Number of extensions: 528029 Number of successful extensions: 1548 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1548 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2588957540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -