BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D15 (1392 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 30 3.8 06_03_1042 - 27089563-27089594,27090017-27090577,27090740-27090797 29 6.6 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 30.3 bits (65), Expect = 3.8 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 181 GXRPXXXPYSXVXXXPXGXXPPXPPLPXGXX*IPXTLXXGGPPPYXTXXXGXGG 20 G P PYS G PP G +P G PPPY G GG Sbjct: 355 GAPPPNPPYSGGAPGGQGSLPPSYDGGYGGRPMPGGGGPGAPPPYHGGGGGGGG 408 >06_03_1042 - 27089563-27089594,27090017-27090577,27090740-27090797 Length = 216 Score = 29.5 bits (63), Expect = 6.6 Identities = 14/51 (27%), Positives = 16/51 (31%) Frame = -2 Query: 203 PSPXHCXRXAPXXGXXFXGXXXPXGXXPPXSXXPXGPTXNPXYPXXGGSPP 51 P P +C P P P S P NP P G+PP Sbjct: 51 PPPPYCVYPPPPTKPALPAPLPPTPASPGDSPPSIAPAGNPPTPAQAGAPP 101 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.310 0.133 0.427 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,145,781 Number of Sequences: 37544 Number of extensions: 303857 Number of successful extensions: 430 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 416 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4385596824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits)
- SilkBase 1999-2023 -