BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D14 (857 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45116| Best HMM Match : EGF (HMM E-Value=0) 29 3.7 SB_5694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 >SB_45116| Best HMM Match : EGF (HMM E-Value=0) Length = 2023 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 523 NYRMGSYLNVELYDLILKAFCNVVDP 600 N++ GS N +LYD K+F +V DP Sbjct: 1973 NFKFGSSKNAQLYDATCKSFGDVRDP 1998 >SB_5694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1113 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +1 Query: 445 DGDDSSWDFGVSAGFYLDATNEPWNN--NYRMGSYLNVEL 558 D D +W + G + AT E NN +YR+G + VEL Sbjct: 1057 DNDRYNWQRPFTKGKFASATGEKINNPRDYRVGDIIGVEL 1096 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,709,194 Number of Sequences: 59808 Number of extensions: 434138 Number of successful extensions: 885 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2443309836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -