BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D10 (904 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g32150.1 68416.m04094 hypothetical protein 29 4.2 At4g15150.1 68417.m02326 glycine-rich protein 29 5.6 At3g14270.1 68416.m01806 phosphatidylinositol-4-phosphate 5-kina... 28 7.4 At5g35170.1 68418.m04168 adenylate kinase family protein contain... 28 9.7 At3g49320.1 68416.m05392 expressed protein contains Pfam profile... 28 9.7 >At3g32150.1 68416.m04094 hypothetical protein Length = 241 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 552 PAERRVFLSRSHTPEPVAVIPDLPP 478 P E + ++ TPEPV + P++PP Sbjct: 162 PVEPEISVTSVETPEPVVIPPEVPP 186 >At4g15150.1 68417.m02326 glycine-rich protein Length = 102 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 467 NRQIGGRSGMTATGSGVWDLDKNTRLSAGGMVSKEFG 577 N +GGR +T TG GV + + G+ K FG Sbjct: 64 NSGVGGRGRLTGTGFGVTGIGLGRKAFGEGLKGKTFG 100 >At3g14270.1 68416.m01806 phosphatidylinositol-4-phosphate 5-kinase family protein similar to SP|Q9Z1T6 FYVE finger-containing phosphoinositide kinase (EC 2.7.1.68) (1- phosphatidylinositol-4-phosphate kinase) (PIP5K) (PtdIns(4)P-5-kinase) {Mus musculus}; contains Pfam profiles PF01504: Phosphatidylinositol-4-phosphate 5-Kinase, PF01363: FYVE zinc finger, PF00118: TCP-1/cpn60 chaperonin family Length = 1791 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 555 VWSRRNSVTEDRTSASRQSSAMIGDPEDPSR 647 V S SVT+ SR+SS + D EDPSR Sbjct: 168 VSSMETSVTKQGKETSRRSSFIATDVEDPSR 198 >At5g35170.1 68418.m04168 adenylate kinase family protein contains Pfam profile: PF00406 adenylate kinase Length = 588 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = -2 Query: 342 IIEDL-SVVTGFTKKPIIVLAQRAEDLPSS 256 II+DL ++ T K+P++++ R +DLP+S Sbjct: 453 IIDDLQAMTTAAGKRPVVLINPRLKDLPAS 482 >At3g49320.1 68416.m05392 expressed protein contains Pfam profile PF03690: Uncharacterised protein family (UPF0160) Length = 354 Score = 27.9 bits (59), Expect = 9.7 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 509 SGVWDLDKNTRLSAGGMVSKEFGHRRPDVGVQAEFRH 619 S V+ L NT+LS+ G+V K +G +Q E RH Sbjct: 100 SEVFGLGFNTKLSSAGLVYKHYGLEIISKELQLEQRH 136 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,840,225 Number of Sequences: 28952 Number of extensions: 392888 Number of successful extensions: 951 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 951 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2129873112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -