BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D07 (857 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 4.1 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 9.4 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.6 bits (46), Expect = 4.1 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +1 Query: 316 IATAYDRSKHVVYLGGEDGIYTFDYTTKSAKNFACHKLQHL 438 I + R K V +L DGI FD K N+ K Q + Sbjct: 1174 ICSLIHRKKIVKFL---DGIMAFDIQLKQVVNYKKKKFQRM 1211 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +2 Query: 176 PTRSRLPNQHPXFSVTLLCPKEKRFLNPFT*TLTLKSS 289 P+ + + HP ++ LC K + N T + T SS Sbjct: 980 PSGGKKGSSHPLAALQKLCDKTETHTNNRTHSATSNSS 1017 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,702 Number of Sequences: 336 Number of extensions: 3745 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23763101 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -