BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D07 (857 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC56F2.11 |met6||homoserine O-acetyltransferase|Schizosaccharo... 29 1.1 SPBC646.14c |orc5||origin recognition complex subunit Orc5|Schiz... 28 2.0 SPCC569.07 |||aromatic aminotransferase |Schizosaccharomyces pom... 27 2.6 SPAC13G7.08c |crb3||WD repeat protein Crb3|Schizosaccharomyces p... 27 4.5 SPAC12B10.03 |||WD repeat protein, human WDR20 family|Schizosacc... 26 6.0 >SPBC56F2.11 |met6||homoserine O-acetyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 489 Score = 28.7 bits (61), Expect = 1.1 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 256 SVYLNLNTKEFGEISGINSGIATAYDRSKHVVYLGGE-DGIYTFDYTTKSAKNF 414 S+ L+T + G +S D S V+ LG E DG++TFD + AK+F Sbjct: 365 SITKKLDTHDITRGRGSDSPKEVMKDLSLPVLVLGIESDGLFTFDEQVEIAKSF 418 >SPBC646.14c |orc5||origin recognition complex subunit Orc5|Schizosaccharomyces pombe|chr 2|||Manual Length = 455 Score = 27.9 bits (59), Expect = 2.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 565 QSCXDVGEFWYRSYLTVRIDK 503 Q C V FWYR + V +DK Sbjct: 69 QDCFTVAHFWYRILIKVGVDK 89 >SPCC569.07 |||aromatic aminotransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 470 Score = 27.5 bits (58), Expect = 2.6 Identities = 16/64 (25%), Positives = 30/64 (46%) Frame = +3 Query: 351 VPWWRGWDIYI*LHNEICKEFCVSQVTASGKCSIVPSTASTSRLSILTKKRLSILTVK*D 530 +P ++ WDI I N I E+C+ + G C ++ T +I + L + + D Sbjct: 119 MPQYKDWDIKITNGNTIGLEYCLRLLVNRGDCILIEK--YTYPAAITAMRPLGVKFIPID 176 Query: 531 LYQN 542 + +N Sbjct: 177 MDEN 180 >SPAC13G7.08c |crb3||WD repeat protein Crb3|Schizosaccharomyces pombe|chr 1|||Manual Length = 446 Score = 26.6 bits (56), Expect = 4.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 403 AKNFACHKLQHLANVPLSRPRPLLHDF 483 AKN C L HL + +RP+ +H+F Sbjct: 38 AKNATCTTLNHLLSAQHTRPQLNIHNF 64 >SPAC12B10.03 |||WD repeat protein, human WDR20 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 543 Score = 26.2 bits (55), Expect = 6.0 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +2 Query: 374 YIHLITQRNLQRILRVTSYSIWQMFHCPVHGLYFTTFNPDEK 499 Y+ L+++R ++ + +FH GL T++PD K Sbjct: 336 YLALVSERGTLKLFDFVKEHVLDVFHSYFAGLTCVTWSPDGK 377 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,008,905 Number of Sequences: 5004 Number of extensions: 59945 Number of successful extensions: 163 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 426466470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -