BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D07 (857 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1169 + 24858843-24858993,24859495-24859788,24860303-248603... 31 1.6 02_05_1166 - 34633770-34634301,34634559-34635181,34635279-34637216 29 6.3 >08_02_1169 + 24858843-24858993,24859495-24859788,24860303-24860349, 24860779-24861277,24862233-24862274,24862376-24862666, 24862793-24862932,24863278-24863770,24864105-24864484 Length = 778 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 310 SGIATAYDRSKHVVYLGGED--GIYTFDYTTKSAKNFACHKLQHL 438 + I+ AY K + GE+ G + DYT S ++ CH +Q L Sbjct: 111 TSISQAYRAGKKAYLVNGEEKKGWFPIDYTMSSLQSVICHTVQKL 155 >02_05_1166 - 34633770-34634301,34634559-34635181,34635279-34637216 Length = 1030 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 364 EDGIYTFDYTTKSAKNFACHKLQHLANVPLSR 459 + G ++DY ++ AK F ++ H ++VP SR Sbjct: 691 DPGFCSWDYYSREAKAFHIEEISHASSVPSSR 722 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,731,692 Number of Sequences: 37544 Number of extensions: 349252 Number of successful extensions: 785 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 785 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2397465936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -