BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D07 (857 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 2.1 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 24 2.1 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 24 2.1 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 23 3.6 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 23 3.6 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.8 bits (49), Expect = 2.1 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -1 Query: 374 IPSSPPRYTTC-LLLSYAVAMPELMPDIS-PNSLVLRFK 264 +P PP TTC L S + + + P +S N ++ +K Sbjct: 1080 VPEQPPHDTTCTTLTSQTIRISWMSPPLSAANGVITGYK 1118 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 381 CIYPILSTKVHNVFASIICSSYAR 310 CIY + S F SIIC + + Sbjct: 60 CIYALFSKDFRFAFKSIICKCFCK 83 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 381 CIYPILSTKVHNVFASIICSSYAR 310 CIY + S F SIIC + + Sbjct: 508 CIYALFSKDFRFAFKSIICKCFCK 531 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 23.0 bits (47), Expect = 3.6 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -3 Query: 624 STNIPAELAKYISC--XWPTAIN 562 ST +PA AK +SC W AIN Sbjct: 317 STMLPAVFAKTVSCIDPWIYAIN 339 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 23.0 bits (47), Expect = 3.6 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -3 Query: 624 STNIPAELAKYISC--XWPTAIN 562 ST +PA AK +SC W AIN Sbjct: 317 STMLPAVFAKTVSCIDPWIYAIN 339 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,459 Number of Sequences: 438 Number of extensions: 4105 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27673956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -