BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D06 (875 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31444| Best HMM Match : No HMM Matches (HMM E-Value=.) 184 1e-46 SB_56863| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 3.7 SB_16484| Best HMM Match : MSG (HMM E-Value=0.24) 29 4.9 SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) 29 6.5 >SB_31444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 184 bits (447), Expect = 1e-46 Identities = 86/120 (71%), Positives = 104/120 (86%) Frame = +2 Query: 134 KTGXXHFSAPSHIRRVLMSSPLSKELRQKFNVKSMPIRKDDEVQVVRGHYKGQQVGKVMQ 313 K+ HFSAPS +RR LMS+PLSKELRQK+NV+S+P+RKDDEVQV RGH+K QQVGKV+Q Sbjct: 13 KSRKAHFSAPSSVRRKLMSAPLSKELRQKYNVRSIPVRKDDEVQVTRGHFKSQQVGKVIQ 72 Query: 314 VYRKKFVVYIERIQREKANGATAYVGIHPSKCVIVKLKMNKDRKAILDRRAKGRLAALGK 493 VYRKK+V++I+RIQREKANGAT VGIHPSK IVKLK++KDRK ILDR+ + +LA GK Sbjct: 73 VYRKKWVIHIDRIQREKANGATVSVGIHPSKVEIVKLKIDKDRKKILDRKNRSKLAEKGK 132 >SB_56863| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4248 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = +1 Query: 370 WCNSICRHSPFKVCDCQVEDE*RPQSNPRSQSKGQTGCTWQRQG*IHRGNCHSHG 534 W N IC ++C C+V DE N + ++ G TW R +R + G Sbjct: 525 WHNRICMR--VEICGCKVCDEPLGMENSKIKANDIEGHTWTRNREPYRARLNYRG 577 >SB_16484| Best HMM Match : MSG (HMM E-Value=0.24) Length = 661 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 Query: 544 LRGLHGCGSFLGVFTLVFAKCSQS 473 L GLH CG + VFAKC Q+ Sbjct: 72 LVGLHPCGDLVPTMLKVFAKCDQA 95 >SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) Length = 828 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -1 Query: 461 CDRGLLCGLYSSST*QSHTLKGE-CRHMLLHHWP--FLFESSQCIQQTFYD 318 C G + + ST + L+G+ CR M+L HWP F + + + +T D Sbjct: 325 CKNGKVPVVSGGSTYDTWPLQGDFCRTMMLLHWPNWFSLDELESVDETSKD 375 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,528,408 Number of Sequences: 59808 Number of extensions: 383454 Number of successful extensions: 924 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 924 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -