BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D03 (861 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein b... 31 0.75 At1g04120.1 68414.m00401 ABC transporter family protein Strong s... 28 7.0 At5g58860.1 68418.m07375 cytochrome P450 86A1 (CYP86) (CYP86A1) ... 28 9.2 At2g04620.1 68415.m00470 cation efflux family protein potential ... 28 9.2 >At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein binding region-containing protein similar to U4/U6 snRNP-associated 61 kDa protein [Homo sapiens] GI:18249847; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 485 Score = 31.5 bits (68), Expect = 0.75 Identities = 17/67 (25%), Positives = 31/67 (46%) Frame = +1 Query: 79 LDAPKMKPAIVILCLFVASLYAADSDVPNDILEEXLYNSVVVADYDSAVEXSKHLYEEKK 258 +D + P+ +I+ + V +L S +P D+L++ L D DSA + E K Sbjct: 154 VDLADLLPSAIIMVVSVTALTTKGSALPEDVLQKVLEACDRALDLDSARKKVLEFVESKM 213 Query: 259 SEVITNV 279 + N+ Sbjct: 214 GSIAPNL 220 >At1g04120.1 68414.m00401 ABC transporter family protein Strong similarity to MRP-like ABC transporter gb|U92650 from A. thaliana and canalicular multi-drug resistance protein gb|L49379 from Rattus norvegicus Length = 1514 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = +2 Query: 62 LGNTQDSTLQR*SPL*LFYVFSWHLCMLQIPTSLTTFWRSXFTIASSSPITTV 220 LG +T+Q + + +W + +L +P ++ FW + +ASS + + Sbjct: 1065 LGGFASTTIQLCGIVAVMTNVTWQVFLLVVPVAVACFWMQKYYMASSRELVRI 1117 >At5g58860.1 68418.m07375 cytochrome P450 86A1 (CYP86) (CYP86A1) / CYPLXXXVI / P450-dependent fatty acid omega-hydroxylase identical to Cytochrome P450 86A1 (CYPLXXXVI) (P450-dependent fatty acid omega-hydroxylase) (SP:P48422) [Arabidopsis thaliana] Length = 513 Score = 27.9 bits (59), Expect = 9.2 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +1 Query: 79 LDAPKMKPAIVILCLFVASLYAADSDVPNDILEEXLYNSVVVADYDSAVEXSKHLY-EEK 255 +DA K P+ +L F+ + +P D+L+ N V+ S+V S + Sbjct: 262 IDARKNSPSDDLLSRFLKKRDVNGNVLPTDVLQRIALNFVLAGRDTSSVALSWFFWLVMN 321 Query: 256 KSEVITNVVNKL 291 EV T +VN+L Sbjct: 322 NREVETKIVNEL 333 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 27.9 bits (59), Expect = 9.2 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -1 Query: 189 VKXLLQNVVRDVGICSIQRCH 127 +K ++N+++ G+CSIQR H Sbjct: 727 LKEAMRNILKTKGVCSIQRLH 747 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,022,252 Number of Sequences: 28952 Number of extensions: 232054 Number of successful extensions: 726 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2009406400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -