BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D02 (853 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 32 0.67 03_06_0471 + 34169562-34169892,34170121-34170347 31 0.88 06_03_0874 - 25580417-25580419,25580504-25580604,25580828-255814... 28 8.2 01_01_1145 + 9073973-9074281,9075440-9075998,9076088-9076241,907... 28 8.2 >01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 Length = 580 Score = 31.9 bits (69), Expect = 0.67 Identities = 22/69 (31%), Positives = 28/69 (40%), Gaps = 3/69 (4%) Frame = +1 Query: 145 PVRVVENADSGNGYEPIDNRPYIVNPPKDYNPNGNGYEPI---DNGAYYVDRPQGRPYFK 315 P + + Y P + P V PP Y P +G P N + Y + P GRP Sbjct: 381 PPAAPQQPEEAMSYAPPQSYPPNVRPPSPYMPPPSGPAPPFYGQNQSMY-EPPVGRPNSG 439 Query: 316 PTPFPGARG 342 P P GA G Sbjct: 440 PPPSYGAGG 448 >03_06_0471 + 34169562-34169892,34170121-34170347 Length = 185 Score = 31.5 bits (68), Expect = 0.88 Identities = 17/50 (34%), Positives = 21/50 (42%) Frame = +1 Query: 184 YEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFKPTPFPG 333 Y P P PP Y P+ GY P GAY +P + P +PG Sbjct: 56 YPPAGGYPGAQYPPSGYPPSQGGYPP---GAYPPSGYPQQPGYPPAGYPG 102 >06_03_0874 - 25580417-25580419,25580504-25580604,25580828-25581411, 25581523-25581594,25581667-25581793,25583412-25583516, 25583643-25583676 Length = 341 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = +1 Query: 175 GNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFKPTPF 327 G Y+P R PP+ P Y P G Y +PQG+PY P P+ Sbjct: 247 GETYQPQPQRE--TYPPQ---PQVQPYPPKPQGQPYPPQPQGQPY-PPQPY 291 >01_01_1145 + 9073973-9074281,9075440-9075998,9076088-9076241, 9077475-9077565,9077722-9077793,9077879-9078390, 9078854-9078923,9079514-9079579,9080266-9080570, 9080872-9081006,9081141-9081204,9081429-9081574, 9081669-9081773,9082310-9082490 Length = 922 Score = 28.3 bits (60), Expect = 8.2 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = +1 Query: 136 AQAPVRVVENADSGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFK 315 +QAP R + G+G +N+ Y N PK +P NG Y P G+P++ Sbjct: 102 SQAPNRT--HKFDGHGNPNKNNQAYHRNGPKRRSPAANGTPSYPAAMPYHQHP-GQPFYY 158 Query: 316 PT-PFP 330 P P P Sbjct: 159 PVIPSP 164 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,312,329 Number of Sequences: 37544 Number of extensions: 310595 Number of successful extensions: 637 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 634 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2373961368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -