BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_D01 (858 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 5.4 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 9.4 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 569 WRVPEGRSWSPRLHLIRQTRTTAASPLCRTRR 474 WR P ++ P+L + +RT A P+ + R Sbjct: 261 WREPLPEAYFPKLDSLVASRTWPARPVNQVPR 292 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.4 bits (43), Expect = 9.4 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +2 Query: 338 HSIAVPTDRPVNEQKKAIFNKVKKIIDVAGXEGV 439 + IAV D NE + N +KK+ +A GV Sbjct: 13 YPIAVLIDELKNEDVQLRLNSIKKLSTIALALGV 46 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,741 Number of Sequences: 336 Number of extensions: 2045 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23763101 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -