SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP04_F_C24
         (943 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF219117-1|AAF71999.1|  406|Tribolium castaneum tailless ortholo...    25   0.65 
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   8.0  
DQ414248-1|ABD63010.2|  311|Tribolium castaneum sloppy-paired pr...    22   8.0  

>AF219117-1|AAF71999.1|  406|Tribolium castaneum tailless ortholog
           protein.
          Length = 406

 Score = 25.4 bits (53), Expect = 0.65
 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 5/39 (12%)
 Frame = -1

Query: 508 PXPPXLXPXPXPPPXPX-----PPXPLXXXXPLTPPXPP 407
           P P  + P P  PP        PP P     PL P  PP
Sbjct: 153 PNPSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPPIFPP 191


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = -1

Query: 526  PPXPXTPXPP 497
            PP P TP PP
Sbjct: 1006 PPEPVTPAPP 1015


>DQ414248-1|ABD63010.2|  311|Tribolium castaneum sloppy-paired
           protein.
          Length = 311

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = -1

Query: 535 PFPPPXPXTP 506
           PFPPP P  P
Sbjct: 205 PFPPPYPFYP 214


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 61,970
Number of Sequences: 336
Number of extensions: 1330
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 26478848
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -