BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C24 (943 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83227-3|CAB05726.2| 241|Caenorhabditis elegans Hypothetical pr... 48 7e-06 U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (gr... 46 3e-05 Z46676-8|CAB60993.2| 388|Caenorhabditis elegans Hypothetical pr... 46 4e-05 U24189-3|AAC47514.1| 398|Caenorhabditis elegans RRM-type RNA bi... 46 4e-05 AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical ... 45 7e-05 U41543-12|AAZ91345.1| 401|Caenorhabditis elegans Groundhog (hed... 42 8e-04 U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (gr... 42 8e-04 Z68215-7|CAA92453.1| 289|Caenorhabditis elegans Hypothetical pr... 41 0.001 AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical ... 41 0.001 U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical pr... 40 0.002 AL022716-5|CAB97232.1| 291|Caenorhabditis elegans Hypothetical ... 40 0.002 AF000298-11|AAM97960.1| 518|Caenorhabditis elegans Prion-like-(... 40 0.002 AF000298-10|AAM97961.1| 539|Caenorhabditis elegans Prion-like-(... 40 0.002 AF000298-8|AAC48255.2| 524|Caenorhabditis elegans Prion-like-(q... 40 0.002 U58751-5|AAN84882.1| 781|Caenorhabditis elegans Wasp (actin cyt... 40 0.003 U58751-4|AAN84881.1| 607|Caenorhabditis elegans Wasp (actin cyt... 40 0.003 AF043706-2|AAB97604.2| 730|Caenorhabditis elegans Hypothetical ... 40 0.003 U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical pr... 39 0.005 U40187-5|AAS80343.1| 1437|Caenorhabditis elegans Cytokinesis def... 39 0.005 U40187-4|AAS80342.1| 1435|Caenorhabditis elegans Cytokinesis def... 39 0.005 AF062008-1|AAC17501.1| 1018|Caenorhabditis elegans unknown protein. 39 0.005 Z66565-6|CAA91483.1| 165|Caenorhabditis elegans Hypothetical pr... 38 0.008 U41557-2|AAA83301.1| 309|Caenorhabditis elegans Hypothetical pr... 38 0.008 U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical pr... 38 0.010 AL023835-10|CAA19494.2| 691|Caenorhabditis elegans Hypothetical... 38 0.010 U46675-2|AAB52644.1| 125|Caenorhabditis elegans Hypothetical pr... 38 0.014 AF098500-3|ABD94103.1| 774|Caenorhabditis elegans Temporarily a... 37 0.018 AF098500-2|AAC67399.2| 996|Caenorhabditis elegans Temporarily a... 37 0.018 Z68338-7|CAA92756.2| 866|Caenorhabditis elegans Hypothetical pr... 37 0.024 AL032646-7|CAA21680.1| 485|Caenorhabditis elegans Hypothetical ... 36 0.042 AC084154-11|AAK29874.1| 350|Caenorhabditis elegans Hypothetical... 36 0.042 U23515-9|AAP82644.1| 360|Caenorhabditis elegans Hypothetical pr... 32 0.051 Z93393-1|CAB07688.1| 497|Caenorhabditis elegans Hypothetical pr... 36 0.056 Z83219-3|CAD57687.1| 965|Caenorhabditis elegans Hypothetical pr... 36 0.056 Z78013-1|CAB01425.3| 1140|Caenorhabditis elegans Hypothetical pr... 36 0.056 U39666-1|AAA80412.2| 644|Caenorhabditis elegans Nematode astaci... 36 0.056 AF535160-1|AAN33048.1| 468|Caenorhabditis elegans UNC-34 protein. 36 0.056 AC025722-6|AAO12398.1| 310|Caenorhabditis elegans Uncoordinated... 36 0.056 AC025722-5|AAO12397.1| 454|Caenorhabditis elegans Uncoordinated... 36 0.056 Z48367-5|CAE54886.1| 993|Caenorhabditis elegans Hypothetical pr... 35 0.073 Z48367-4|CAA88324.1| 1110|Caenorhabditis elegans Hypothetical pr... 35 0.073 AF016448-12|AAB65959.1| 316|Caenorhabditis elegans Hypothetical... 35 0.073 AF106580-3|AAC78205.1| 881|Caenorhabditis elegans Temporarily a... 35 0.097 AC025716-21|AAT39978.1| 586|Caenorhabditis elegans Hypothetical... 34 0.13 AC025716-20|AAT39977.2| 946|Caenorhabditis elegans Hypothetical... 34 0.13 Z82083-3|CAB04971.1| 756|Caenorhabditis elegans Hypothetical pr... 33 0.22 Z70309-6|CAA94360.1| 324|Caenorhabditis elegans Hypothetical pr... 33 0.30 Z79596-1|CAB01857.1| 830|Caenorhabditis elegans Hypothetical pr... 33 0.39 L29031-1|AAB72228.2| 830|Caenorhabditis elegans dynamin protein. 33 0.39 AF025467-5|AAB71038.2| 1115|Caenorhabditis elegans Hypothetical ... 33 0.39 AC006651-1|AAF39870.4| 1138|Caenorhabditis elegans Hypothetical ... 33 0.39 Z74472-4|CAA98942.1| 301|Caenorhabditis elegans Hypothetical pr... 32 0.52 Z73910-4|CAA98136.1| 662|Caenorhabditis elegans Hypothetical pr... 32 0.52 V00147-1|CAA23463.1| 296|Caenorhabditis elegans protein ( Caeno... 32 0.52 U23515-8|AAP82645.1| 362|Caenorhabditis elegans Hypothetical pr... 32 0.52 J01047-1|AAA27988.1| 296|Caenorhabditis elegans protein ( C.ele... 32 0.52 Z73102-2|CAB63428.1| 341|Caenorhabditis elegans Hypothetical pr... 32 0.68 Z73102-1|CAA97419.1| 298|Caenorhabditis elegans Hypothetical pr... 32 0.68 Z34533-1|CAA84302.3| 730|Caenorhabditis elegans Hypothetical pr... 32 0.68 U67967-1|AAC47829.1| 413|Caenorhabditis elegans PTL-1B protein ... 32 0.68 U67966-1|AAB97090.1| 453|Caenorhabditis elegans PTL-1A protein ... 32 0.68 U38983-1|AAA80687.1| 436|Caenorhabditis elegans TAU-1b protein. 32 0.68 U38982-1|AAA80686.1| 431|Caenorhabditis elegans TAU-1a protein. 32 0.68 U00051-4|AAK70645.1| 453|Caenorhabditis elegans Protein with ta... 32 0.68 U00051-3|AAK70647.1| 413|Caenorhabditis elegans Protein with ta... 32 0.68 U00051-2|AAK70646.1| 458|Caenorhabditis elegans Protein with ta... 32 0.68 Z77662-5|CAB01192.2| 579|Caenorhabditis elegans Hypothetical pr... 31 0.90 Z69658-1|CAA93481.1| 418|Caenorhabditis elegans Hypothetical pr... 31 0.90 AC006708-23|AAF60414.1| 975|Caenorhabditis elegans Paz/piwi dom... 31 0.90 Z98866-8|CAB11562.2| 425|Caenorhabditis elegans Hypothetical pr... 31 1.2 Z69360-4|CAC42291.2| 732|Caenorhabditis elegans Hypothetical pr... 31 1.2 Z69360-3|CAA93286.2| 369|Caenorhabditis elegans Hypothetical pr... 31 1.2 Z69360-2|CAA93285.2| 780|Caenorhabditis elegans Hypothetical pr... 31 1.2 U53333-2|AAA96155.1| 299|Caenorhabditis elegans Collagen protei... 31 1.2 M80650-1|AAA27985.1| 298|Caenorhabditis elegans alpha-collagen ... 31 1.2 AL110490-7|CAD59175.1| 533|Caenorhabditis elegans Hypothetical ... 31 1.2 AL110490-6|CAB54442.2| 687|Caenorhabditis elegans Hypothetical ... 31 1.2 AL033536-4|CAA22144.2| 1582|Caenorhabditis elegans Hypothetical ... 31 1.2 AF410845-1|AAL76233.1| 299|Caenorhabditis elegans cuticular col... 31 1.2 AC006611-4|AAK85456.2| 328|Caenorhabditis elegans Hypothetical ... 31 1.2 Z82269-5|CAH60772.1| 618|Caenorhabditis elegans Hypothetical pr... 31 1.6 Z82269-4|CAB70200.2| 633|Caenorhabditis elegans Hypothetical pr... 31 1.6 Z79596-2|CAC42251.1| 838|Caenorhabditis elegans Hypothetical pr... 31 1.6 U93842-1|AAB52421.1| 1409|Caenorhabditis elegans regulator of pr... 31 1.6 U70845-1|AAB09098.1| 79|Caenorhabditis elegans Hypothetical pr... 31 1.6 U58736-1|AAB00598.1| 302|Caenorhabditis elegans Dumpy : shorter... 31 1.6 U50310-5|AAA92541.1| 318|Caenorhabditis elegans Ground-like (gr... 31 1.6 U49945-3|AAM51509.1| 1408|Caenorhabditis elegans Aboc, expulsion... 31 1.6 U49945-2|AAC47926.1| 1409|Caenorhabditis elegans Aboc, expulsion... 31 1.6 U38378-1|AAA79751.1| 418|Caenorhabditis elegans Hypothetical pr... 31 1.6 AL021487-15|CAH60766.1| 618|Caenorhabditis elegans Hypothetical... 31 1.6 AL021487-14|CAA16360.3| 633|Caenorhabditis elegans Hypothetical... 31 1.6 AF167982-1|AAD50438.1| 838|Caenorhabditis elegans dynamin protein. 31 1.6 AF000193-1|AAB52891.1| 715|Caenorhabditis elegans Hypothetical ... 31 1.6 U40802-2|AAM81104.1| 1010|Caenorhabditis elegans Dense body prot... 29 1.9 J04804-1|AAA28002.1| 1010|Caenorhabditis elegans protein ( C.ele... 29 1.9 U40802-1|AAM81106.1| 999|Caenorhabditis elegans Dense body prot... 29 1.9 U40802-3|AAM81105.1| 369|Caenorhabditis elegans Dense body prot... 29 2.0 Z95559-1|CAB08999.1| 289|Caenorhabditis elegans Hypothetical pr... 30 2.1 Z82274-16|CAC70096.1| 1119|Caenorhabditis elegans Hypothetical p... 30 2.1 Z82274-15|CAB05234.2| 1113|Caenorhabditis elegans Hypothetical p... 30 2.1 Z82095-2|CAB05027.2| 602|Caenorhabditis elegans Hypothetical pr... 30 2.1 Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical pr... 30 2.1 Z69903-7|CAA93776.1| 1607|Caenorhabditis elegans Hypothetical pr... 30 2.1 Z69660-1|CAA93489.1| 1607|Caenorhabditis elegans Hypothetical pr... 30 2.1 U88314-13|ABR92611.1| 1346|Caenorhabditis elegans Formin homolog... 30 2.1 AL132951-13|CAC70127.1| 1119|Caenorhabditis elegans Hypothetical... 30 2.1 AL132951-12|CAC44311.1| 1113|Caenorhabditis elegans Hypothetical... 30 2.1 AL132949-22|CAB70112.2| 603|Caenorhabditis elegans Hypothetical... 30 2.1 AF283323-1|AAG18575.1| 1113|Caenorhabditis elegans synaptojanin ... 30 2.1 AF283322-1|AAG18574.1| 1119|Caenorhabditis elegans synaptojanin ... 30 2.1 AF098501-3|AAM69106.1| 275|Caenorhabditis elegans Hypothetical ... 30 2.1 AF098501-2|AAM69105.1| 298|Caenorhabditis elegans Hypothetical ... 30 2.1 AF098501-1|AAC67404.2| 548|Caenorhabditis elegans Hypothetical ... 30 2.1 AC084158-11|AAK68558.1| 555|Caenorhabditis elegans Hypothetical... 30 2.1 AC006666-4|AAK21415.1| 109|Caenorhabditis elegans Hypothetical ... 30 2.1 AB084086-1|BAC67013.1| 1346|Caenorhabditis elegans Formactin pro... 30 2.1 Z66511-5|CAA91317.1| 1095|Caenorhabditis elegans Hypothetical pr... 30 2.8 Z46937-1|CAA87056.2| 1036|Caenorhabditis elegans Hypothetical pr... 30 2.8 U97196-12|AAB52456.2| 564|Caenorhabditis elegans Hypothetical p... 30 2.8 U40421-1|AAA81437.2| 178|Caenorhabditis elegans Helix loop heli... 30 2.8 AF037063-1|AAC26105.1| 178|Caenorhabditis elegans twist protein. 30 2.8 AF003151-19|AAK18922.1| 988|Caenorhabditis elegans Hypothetical... 30 2.8 AC024859-11|AAK29981.1| 933|Caenorhabditis elegans Hypothetical... 30 2.8 AC024859-10|ABA00158.1| 832|Caenorhabditis elegans Hypothetical... 30 2.8 AC006696-4|AAF39985.1| 215|Caenorhabditis elegans Hypothetical ... 30 2.8 Z79756-9|CAK12562.1| 830|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z79756-8|CAB02122.1| 891|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z79756-7|CAK12561.1| 855|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z74042-8|CAA98525.1| 299|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z74036-2|CAA98487.1| 266|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z74036-1|CAA98486.1| 299|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z74031-17|CAN86923.1| 380|Caenorhabditis elegans Hypothetical p... 29 3.6 Z74031-16|CAA98452.1| 378|Caenorhabditis elegans Hypothetical p... 29 3.6 Z68760-2|CAA92995.1| 597|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z68219-2|CAA92476.1| 300|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z66563-2|CAA91469.3| 2557|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z37983-4|CAA86057.1| 803|Caenorhabditis elegans Hypothetical pr... 29 3.6 U88172-5|AAB42260.1| 483|Caenorhabditis elegans Hypothetical pr... 29 3.6 U53155-5|AAC48270.1| 303|Caenorhabditis elegans Collagen protei... 29 3.6 U00058-3|AAD31933.1| 162|Caenorhabditis elegans Ground-like (gr... 29 3.6 AL132864-1|CAB63392.1| 613|Caenorhabditis elegans Hypothetical ... 29 3.6 AF025467-2|AAN65301.1| 505|Caenorhabditis elegans Hypothetical ... 29 3.6 AF025467-1|AAB71039.2| 528|Caenorhabditis elegans Hypothetical ... 29 3.6 AC024772-3|AAF60538.1| 2344|Caenorhabditis elegans Hypothetical ... 29 3.6 AC006638-2|AAK85481.1| 1256|Caenorhabditis elegans Cyclase assoc... 29 3.6 AC006638-1|AAK85482.1| 495|Caenorhabditis elegans Cyclase assoc... 29 3.6 AB072926-1|BAB69889.1| 303|Caenorhabditis elegans collagen prot... 29 3.6 U61954-7|AAK29803.1| 1140|Caenorhabditis elegans Hypothetical pr... 24 4.0 U61954-8|AAM98018.1| 1005|Caenorhabditis elegans Hypothetical pr... 24 4.1 Z83316-8|CAB54186.1| 409|Caenorhabditis elegans Hypothetical pr... 29 4.8 Z83114-7|CAJ76943.1| 525|Caenorhabditis elegans Hypothetical pr... 29 4.8 Z83114-6|CAB63235.1| 589|Caenorhabditis elegans Hypothetical pr... 29 4.8 Z81055-7|CAB02897.2| 445|Caenorhabditis elegans Hypothetical pr... 29 4.8 U58757-9|AAM75377.1| 503|Caenorhabditis elegans Hypothetical pr... 29 4.8 U58757-8|AAC47918.3| 506|Caenorhabditis elegans Hypothetical pr... 29 4.8 U53333-6|AAA96159.2| 304|Caenorhabditis elegans Collagen protei... 29 4.8 AL132898-14|CAC14406.1| 1641|Caenorhabditis elegans Hypothetical... 29 4.8 AL117204-20|CAB55136.2| 699|Caenorhabditis elegans Hypothetical... 29 4.8 AJ243905-1|CAB64866.1| 699|Caenorhabditis elegans SF1 protein p... 29 4.8 AF098999-4|AAC68729.1| 659|Caenorhabditis elegans Hypothetical ... 29 4.8 Z98866-26|CAM33505.1| 559|Caenorhabditis elegans Hypothetical p... 29 6.4 Z81135-1|CAB03453.1| 627|Caenorhabditis elegans Hypothetical pr... 29 6.4 Z70266-6|CAD57691.1| 795|Caenorhabditis elegans Hypothetical pr... 29 6.4 Z70266-5|CAA94208.1| 798|Caenorhabditis elegans Hypothetical pr... 29 6.4 Z70208-2|CAA94136.1| 304|Caenorhabditis elegans Hypothetical pr... 29 6.4 Z70205-10|CAA94122.2| 887|Caenorhabditis elegans Hypothetical p... 29 6.4 Z69664-10|CAC42313.1| 1311|Caenorhabditis elegans Hypothetical p... 29 6.4 Z69664-9|CAA93519.2| 1470|Caenorhabditis elegans Hypothetical pr... 29 6.4 Z68880-11|CAC42342.1| 1311|Caenorhabditis elegans Hypothetical p... 29 6.4 Z68880-10|CAA93100.2| 1470|Caenorhabditis elegans Hypothetical p... 29 6.4 Z68003-5|CAA91979.2| 887|Caenorhabditis elegans Hypothetical pr... 29 6.4 U56966-4|AAA98719.2| 906|Caenorhabditis elegans Ace(angiotensin... 29 6.4 U56966-3|AAU05584.1| 332|Caenorhabditis elegans Ace(angiotensin... 29 6.4 U41557-6|AAA83307.1| 589|Caenorhabditis elegans Collagen sequen... 29 6.4 AY438643-1|AAR00670.1| 627|Caenorhabditis elegans abnormal DAue... 29 6.4 AL023827-4|CAD57709.1| 795|Caenorhabditis elegans Hypothetical ... 29 6.4 AL023827-3|CAA19446.1| 798|Caenorhabditis elegans Hypothetical ... 29 6.4 AF308449-1|AAL09435.1| 1347|Caenorhabditis elegans PXF isoform C... 29 6.4 AF308448-1|AAL09434.1| 1311|Caenorhabditis elegans PXF isoform B... 29 6.4 AF308447-1|AAL09433.1| 1470|Caenorhabditis elegans PXF isoform A... 29 6.4 AF170796-1|AAF22963.1| 1470|Caenorhabditis elegans RA-GEF protein. 29 6.4 AC024200-14|AAF36005.1| 557|Caenorhabditis elegans Hypothetical... 29 6.4 Z99773-3|CAE11316.1| 305|Caenorhabditis elegans Hypothetical pr... 28 8.4 Z84574-5|CAB06541.1| 846|Caenorhabditis elegans Hypothetical pr... 28 8.4 Z81129-3|CAB03404.1| 1262|Caenorhabditis elegans Hypothetical pr... 28 8.4 Z81034-4|CAB02729.1| 541|Caenorhabditis elegans Hypothetical pr... 28 8.4 Z79604-3|CAD36502.1| 817|Caenorhabditis elegans Hypothetical pr... 28 8.4 Z79604-2|CAB01900.1| 780|Caenorhabditis elegans Hypothetical pr... 28 8.4 Z35640-1|CAA84705.1| 307|Caenorhabditis elegans Hypothetical pr... 28 8.4 U80447-9|AAB37813.1| 230|Caenorhabditis elegans Hypothetical pr... 28 8.4 AF332205-1|AAK17976.1| 817|Caenorhabditis elegans nuclear recep... 28 8.4 AF332204-1|AAK17975.1| 519|Caenorhabditis elegans nuclear recep... 28 8.4 AF125964-1|AAD14753.1| 471|Caenorhabditis elegans Hypothetical ... 28 8.4 AF067209-1|AAC16982.2| 553|Caenorhabditis elegans Warthog (hedg... 28 8.4 AC084153-9|AAK84592.1| 90|Caenorhabditis elegans Hypothetical ... 28 8.4 Z19158-2|CAA79571.3| 262|Caenorhabditis elegans Hypothetical pr... 23 9.9 >Z83227-3|CAB05726.2| 241|Caenorhabditis elegans Hypothetical protein F45B8.3 protein. Length = 241 Score = 48.4 bits (110), Expect = 7e-06 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP--PXPLXXXXPLTPPXPPP 404 SP P+ PP P P PP P P P P P P P P PP PPP Sbjct: 77 SPSCCPYVPPAPLPPPPPPASPCCGPSPVPAPCCPPPPAPAAPCCPPPPPP 127 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 SP P P P P P PP PPP P P PL P P Sbjct: 97 SPCCGPSPVPAPCCPPPPAPAAPCCPPPPPPTPSPLVCCKQAPVPENP 144 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -1 Query: 523 PXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP-XPPPXXP 395 P P P + P P PPP P P P P+ P PPP P Sbjct: 74 PRPSPSCCPYVPPAPLPPP-PPPASPCCGPSPVPAPCCPPPPAP 116 >U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (grd related) protein 4 protein. Length = 210 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/42 (47%), Positives = 21/42 (50%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP P P PP P PPP PP P P+ PP PPP Sbjct: 40 PPPLPCPP-PPICPPQFCPPPPMCPPPPPPPPPPMCPPPPPP 80 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXP-PPXPXPPXPLXXXXPLTPPXPPPXXP 395 PPP P P PP P P P PP P P P+ PP PPP P Sbjct: 27 PPPCPPPP-PPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPPPPP 71 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P PPP P P P P PP PP P+ P PP PPP P Sbjct: 27 PPPCPPPPPPMCAPPPLPCPPPPICPPQFCPPPPMCPPPP--PPPPPPMCP 75 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -1 Query: 532 FPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 F PP P P PP P P PP P PP P+ P P P Sbjct: 55 FCPPPPMCPPPP---PPPPPPMCPPPPPPMPSYSPCQSYAPAP 94 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXP 455 P PP P P PP P P P P P Sbjct: 60 PMCPPPPPPPPPPMCPPPPPPMPSYSP 86 >Z46676-8|CAB60993.2| 388|Caenorhabditis elegans Hypothetical protein C08B11.5 protein. Length = 388 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/48 (45%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -1 Query: 535 PFPPPXPX-TPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP P TP PP + P P P P PP P P PP PP P Sbjct: 262 PVPPPPPSVTPMPPPMPPTPGMTPRP-PPPPSSGMWPPPPPPPPGRTP 308 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 7/55 (12%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXP-----XPPPXPXPP--XPLXXXXPLTPPXPPP 404 P P PPP P TP P P PPP P PP P P PP PPP Sbjct: 268 PSVTPMPPPMPPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPPPPPP 322 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 11/58 (18%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPP-----------XPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP TP PP + P PPP P PP P PP PPP P Sbjct: 299 PPPPPPGRTPGPPGMPGMPPPPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYP 356 Score = 35.9 bits (79), Expect = 0.042 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP P P P P PPP P P + PP PPP Sbjct: 348 PPPPP--PRYPSAGPGMYPPPPPSRPPAPPSGHGMIPPPPPP 387 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/60 (35%), Positives = 23/60 (38%), Gaps = 8/60 (13%) Frame = -1 Query: 550 SPXXXPFPPPXPXT-------PXPPXLXPXPXPPP-XPXPPXPLXXXXPLTPPXPPPXXP 395 +P P PPP P + P PP P P P P PP P P PPP P Sbjct: 280 TPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPPPPPPSRFGPPGMGGMPPPPPP 339 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPP 407 F P PPP P P P P PP P P P PP PP Sbjct: 325 FGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSRPPAPP 375 Score = 31.9 bits (69), Expect = 0.68 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 10/55 (18%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPX---------PXPPXPLXXXXP-LTPPXPPPXXP 395 PPP P PP + P PPP P PP P + PP PP P Sbjct: 318 PPPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSRPP 372 Score = 31.5 bits (68), Expect = 0.90 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -1 Query: 517 PXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP----XPPPXXP 395 P P PP P P P P PP P P PP PPP P Sbjct: 261 PPVPPPP---PSVTPMPPPMPPTPGMTPRPPPPPSSGMWPPPPPP 302 Score = 31.5 bits (68), Expect = 0.90 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 10/61 (16%) Frame = -1 Query: 547 PXXXPFPPPXPXTP-XPPXLXPXPXPPP---------XPXPPXPLXXXXPLTPPXPPPXX 398 P PPP P + PP + P PPP P PP P P PPP Sbjct: 311 PGMPGMPPPPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSR 370 Query: 397 P 395 P Sbjct: 371 P 371 >U24189-3|AAC47514.1| 398|Caenorhabditis elegans RRM-type RNA binding protein protein. Length = 398 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/48 (45%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -1 Query: 535 PFPPPXPX-TPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP P TP PP + P P P P PP P P PP PP P Sbjct: 272 PVPPPPPSVTPMPPPMPPTPGMTPRP-PPPPSSGMWPPPPPPPPGRTP 318 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 7/55 (12%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXP-----XPPPXPXPP--XPLXXXXPLTPPXPPP 404 P P PPP P TP P P PPP P PP P P PP PPP Sbjct: 278 PSVTPMPPPMPPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPPPPPP 332 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 11/58 (18%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPP-----------XPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP TP PP + P PPP P PP P PP PPP P Sbjct: 309 PPPPPPGRTPGPPGMPGMPPPPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYP 366 Score = 35.9 bits (79), Expect = 0.042 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP P P P P PPP P P + PP PPP Sbjct: 358 PPPPP--PRYPSAGPGMYPPPPPSRPPAPPSGHGMIPPPPPP 397 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/60 (35%), Positives = 23/60 (38%), Gaps = 8/60 (13%) Frame = -1 Query: 550 SPXXXPFPPPXPXT-------PXPPXLXPXPXPPP-XPXPPXPLXXXXPLTPPXPPPXXP 395 +P P PPP P + P PP P P P P PP P P PPP P Sbjct: 290 TPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPPPPPPSRFGPPGMGGMPPPPPP 349 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPP 407 F P PPP P P P P PP P P P PP PP Sbjct: 335 FGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSRPPAPP 385 Score = 31.9 bits (69), Expect = 0.68 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 10/55 (18%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPX---------PXPPXPLXXXXP-LTPPXPPPXXP 395 PPP P PP + P PPP P PP P + PP PP P Sbjct: 328 PPPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSRPP 382 Score = 31.5 bits (68), Expect = 0.90 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -1 Query: 517 PXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP----XPPPXXP 395 P P PP P P P P PP P P PP PPP P Sbjct: 271 PPVPPPP---PSVTPMPPPMPPTPGMTPRPPPPPSSGMWPPPPPP 312 Score = 31.5 bits (68), Expect = 0.90 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 10/61 (16%) Frame = -1 Query: 547 PXXXPFPPPXPXTP-XPPXLXPXPXPPP---------XPXPPXPLXXXXPLTPPXPPPXX 398 P PPP P + PP + P PPP P PP P P PPP Sbjct: 321 PGMPGMPPPPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSR 380 Query: 397 P 395 P Sbjct: 381 P 381 >AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical protein F59E12.9 protein. Length = 1621 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = -1 Query: 535 PFPPPXPXTPXPP--XLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P PPP P P PP L P P PPP P PL P PPP Sbjct: 1336 PSPPPPPPPPPPPSDDLTPVPPPPPPPPTMSKAPTGVPLPVPPPPP 1381 Score = 35.1 bits (77), Expect = 0.073 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 +P P PPP P P P P P PP PL + PP PPP Sbjct: 1353 TPVPPP-PPPPPTMSKAPTGVPLPVP-----PPPPLFSPSMILPPPPPP 1395 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 481 PXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP P PP P LTP PPP P Sbjct: 1336 PSPPPPPPPPPP--PSDDLTPVPPPPPPP 1362 Score = 32.7 bits (71), Expect = 0.39 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Frame = -1 Query: 511 TPXPPXLXPXPXPP-------PXPXPPXPLXXXXPLTPPXPPPXXP 395 +P PP P P PP P P PP P P P P P P Sbjct: 1335 SPSPPPPPPPPPPPSDDLTPVPPPPPPPPTMSKAPTGVPLPVPPPP 1380 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXP 446 PPP P P P P PPP P P Sbjct: 1585 PPPLMGGPPPRLGMPPPGPPPPNGGPPP 1612 >U41543-12|AAZ91345.1| 401|Caenorhabditis elegans Groundhog (hedgehog-like family)protein 7 protein. Length = 401 Score = 41.5 bits (93), Expect = 8e-04 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXP----PXPLXXXXPLTPPXPPPXXP 395 P P P P P P P P PPP P P P P PP PPP P Sbjct: 93 PVPAPPP-APYPQHAVPAPAPPPAPYPQHAVPAPAPYQQQPPPPPPPPHYP 142 Score = 35.9 bits (79), Expect = 0.042 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P P P P P P PP P P PP PP P Sbjct: 108 PAPAPPP-APYPQHAVPAPAPYQQQPPPPPPPPHYPPPPPHYPPPPP 153 Score = 34.7 bits (76), Expect = 0.097 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P P P P P PPP P P + P P P Sbjct: 50 PPPPPAPYPQQAVPAPAPPPAPYPQHAVPAPAPPLASYPQNAVP 93 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXP 410 +P P P P P P P PPP P P P PP P Sbjct: 109 APAPPPAPYPQHAVPAPAPYQQQPPPPPPPPHYPPPPPHYPPPPPAP 155 Score = 32.7 bits (71), Expect = 0.39 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 + S P P TP PP P PPP P P T P PPP Sbjct: 8 YKSQTTYPESAPAATTPQPPP----PPPPPKPAPYVEQSAQPQQTAPPPPP 54 Score = 32.7 bits (71), Expect = 0.39 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -1 Query: 535 PFPPPXPXTPXP-PXLXPXPXPPPXPXPPXPLXXXXPLTP-PXPPP 404 P PPP P P P P + P PP P P P PPP Sbjct: 24 PQPPPPPPPPKPAPYVEQSAQPQQTAPPPPPAPYPQQAVPAPAPPP 69 Score = 32.7 bits (71), Expect = 0.39 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P P P PPP P P + P PP P P Sbjct: 78 PAPAP-PLASYPQNAVPVPAPPPAPYPQHAV--PAPAPPPAPYP 118 Score = 32.3 bits (70), Expect = 0.52 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P P P P PPP P PP P PP PP Sbjct: 108 PAPAPPPAPYPQHAVPAPAPYQQQPPPPPPPPH-YPPPPPHYPPPPP 153 Score = 31.5 bits (68), Expect = 0.90 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = -1 Query: 535 PFPPPXPXTPXP---PXLXPXPXPPPXPXPPXP-LXXXXPLTPPXPPP 404 P PPP P P P P PP P P P P PP P P Sbjct: 26 PPPPPPPPKPAPYVEQSAQPQQTAPPPPPAPYPQQAVPAPAPPPAPYP 73 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPX-PXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P PP P P PPP PP P + P P Sbjct: 123 PAPAPYQQQPPPPPPPPHYPPPPPHYPPPPPAPHSAYIDHSAPRP 167 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/49 (28%), Positives = 17/49 (34%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 +P P+P P PP P P PP + P PPP Sbjct: 66 APPPAPYPQHAVPAPAPPLASYPQNAVPVPAPPPAPYPQHAVPAPAPPP 114 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = -1 Query: 502 PPXLXPXPXPPPXPXPPXPL--XXXXPLTPPXPPPXXP 395 P P P PPP P P P P PPP P Sbjct: 19 PAATTPQPPPPPPPPKPAPYVEQSAQPQQTAPPPPPAP 56 >U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (grd related) protein 6 protein. Length = 240 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPX--PXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P P PP P PP P PP P P PP P P P Sbjct: 46 PMPMPMPVCPPPPPCPAQFCPPPPICPPPPPPPMPCPPPPPPMPRPSCP 94 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P F PP P P PP P P PPP P P P P P P Sbjct: 59 PCPAQFCPPPPICPPPPP-PPMPCPPPPPPMPRPSCPCMMQRPSFYPSYVP 108 Score = 36.7 bits (81), Expect = 0.024 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXP---XPPXPLXXXXPLTP-PXPPPXXP 395 +P P P P P + P PPP P PP P+ P P P PPP P Sbjct: 32 TPMCQPRMPCAAPMPMPMPMPVCPPPPPCPAQFCPPPPICPPPPPPPMPCPPPPPP 87 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -1 Query: 535 PFPPPXPXTPXP-PXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P P P P P P PP P P P PPP P Sbjct: 31 PTPMCQPRMPCAAPMPMPMPMPVCPPPPPCPAQFCPP-PPICPPPPPP 77 >Z68215-7|CAA92453.1| 289|Caenorhabditis elegans Hypothetical protein C53B4.5 protein. Length = 289 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = -1 Query: 529 PPPXPXTPX-PPXLXPXPXPPPXPX-PPXPLXXXXPLTPPXPP-PXXP 395 PP P P PP P P PP P PP P PL PP PP P P Sbjct: 122 PPKEPCEPITPPPCKPCPEGPPGPAGPPGPQGNKGPLGPPGPPGPEGP 169 >AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical protein Y48G9A.4 protein. Length = 1115 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/44 (47%), Positives = 22/44 (50%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P PPP P P P L P PPP PP P+ P PP PPP Sbjct: 559 PIPPPPPP-PLPQNLSGAPPPPP---PPPPMLGGPP--PPPPPP 596 Score = 36.3 bits (80), Expect = 0.032 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 8/55 (14%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPX--------PXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP P PP + P PPP PP PL PP PPP P Sbjct: 533 PAPPPVSSIPPPPPIAGLLAANGTNVPIPPP---PPPPLPQNLSGAPPPPPPPPP 584 >U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical protein B0280.13 protein. Length = 616 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/51 (39%), Positives = 22/51 (43%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P +P P + P PPP P PP P PP PPP P Sbjct: 475 PPPSRIPNPSP-SPQPAEVSKSP-PPPPPLPPIATPSSVPPPPPPPPPPPP 523 Score = 35.9 bits (79), Expect = 0.042 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPP-----PXPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP P P P P P P P PP P PP PPP P Sbjct: 472 PAPPPPSRIPNPS---PSPQPAEVSKSPPPPPPLPPIATPSSVPPPPPPPPP 520 Score = 35.5 bits (78), Expect = 0.056 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 11/56 (19%) Frame = -1 Query: 529 PPPXPX-TPXPPXLXPXPXP----------PPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P P PP P P P PP P P P+ + PP PPP P Sbjct: 466 PPTTPKPAPPPPSRIPNPSPSPQPAEVSKSPPPPPPLPPIATPSSVPPPPPPPPPP 521 Score = 35.5 bits (78), Expect = 0.056 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPX--PXPPPXPXPPXPLXXXXPLTPP 416 PPP P P PP P P PPP P PP P PP Sbjct: 496 PPPPP--PLPPIATPSSVPPPPPPPPPPPPALEQEISGPP 533 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPP-XPXP-PXPLXXXXPLTPPXPPPXXP 395 P T P P P PP P P P P +PP PPP P Sbjct: 459 PSYSSTTPPTTPKPAPPPPSRIPNPSPSPQPAEVSKSPPPPPPLPP 504 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 550 SPXXXPFPPPXPXT-PXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 +P P P + P PP L P P P PP P PP PPP Sbjct: 482 NPSPSPQPAEVSKSPPPPPPLPPIATPSSVPPPPPP--------PPPPPP 523 >AL022716-5|CAB97232.1| 291|Caenorhabditis elegans Hypothetical protein C24F3.6 protein. Length = 291 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = -1 Query: 529 PPPXPXTPX-PPXLXPXPXPPPXPX-PPXPLXXXXPLTPPXPP-PXXP 395 PP P P PP P P PP P PP P PL PP PP P P Sbjct: 124 PPKEPCEPLTPPPCKPCPEGPPGPAGPPGPDGNKGPLGPPGPPGPEGP 171 >AF000298-11|AAM97960.1| 518|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 75, isoform b protein. Length = 518 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPL----TPPXPPP 404 P PPP +P PP P PP PP P P +PP PPP Sbjct: 255 PPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPPPPPP 302 Score = 36.3 bits (80), Expect = 0.032 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP +P PP P PPP P P P PP PPP Sbjct: 265 PPPRTGSPPPPPTGSPP-PPPAGGSPPPPRAGSP--PPPPPP 303 Score = 36.3 bits (80), Expect = 0.032 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P PPP +P PP P PPP P P PPP Sbjct: 276 PTGSPPPPPAGGSPPPPRAGSPPPPPPPRGSPPTGSLPPPQAGGSPPP 323 Score = 35.9 bits (79), Expect = 0.042 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -1 Query: 526 PPXPXT--PXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P T P PP P PP PP P P PP PP P Sbjct: 264 PPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPP--PPPPPRGSP 307 Score = 35.5 bits (78), Expect = 0.056 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P PPP P P P PPP P P P PP P P Sbjct: 233 PAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPP 283 Score = 35.1 bits (77), Expect = 0.073 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P PPP P PP P P PP P P T PPP Sbjct: 272 PPPPPTGSPPPPPAGGSPPPPRAGSPPPPPPPRGSPPTGSLPPP 315 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP +P P PP PP P P P PP P Sbjct: 238 PPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPP 284 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PPP PP P PP PP P PP P Sbjct: 289 PPPPRAGSPPPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPPP 333 Score = 28.3 bits (60), Expect = 8.4 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP--XPPPXXP 395 SP PPP PP P PPP P +PP PP P Sbjct: 306 SPPTGSLPPPQAGGSPPPAGTGSPPPPPRQKRQAPERSPPTGSPPTGSPPTGRP 359 >AF000298-10|AAM97961.1| 539|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 75, isoform c protein. Length = 539 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPL----TPPXPPP 404 P PPP +P PP P PP PP P P +PP PPP Sbjct: 276 PPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPPPPPP 323 Score = 36.3 bits (80), Expect = 0.032 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP +P PP P PPP P P P PP PPP Sbjct: 286 PPPRTGSPPPPPTGSPP-PPPAGGSPPPPRAGSP--PPPPPP 324 Score = 36.3 bits (80), Expect = 0.032 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P PPP +P PP P PPP P P PPP Sbjct: 297 PTGSPPPPPAGGSPPPPRAGSPPPPPPPRGSPPTGSLPPPQAGGSPPP 344 Score = 35.9 bits (79), Expect = 0.042 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -1 Query: 526 PPXPXT--PXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P T P PP P PP PP P P PP PP P Sbjct: 285 PPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPP--PPPPPRGSP 328 Score = 35.5 bits (78), Expect = 0.056 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P PPP P P P PPP P P P PP P P Sbjct: 254 PAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPP 304 Score = 35.1 bits (77), Expect = 0.073 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P PPP P PP P P PP P P T PPP Sbjct: 293 PPPPPTGSPPPPPAGGSPPPPRAGSPPPPPPPRGSPPTGSLPPP 336 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP +P P PP PP P P P PP P Sbjct: 259 PPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPP 305 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PPP PP P PP PP P PP P Sbjct: 310 PPPPRAGSPPPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPPP 354 Score = 28.3 bits (60), Expect = 8.4 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP--XPPPXXP 395 SP PPP PP P PPP P +PP PP P Sbjct: 327 SPPTGSLPPPQAGGSPPPAGTGSPPPPPRQKRQAPERSPPTGSPPTGSPPTGRP 380 >AF000298-8|AAC48255.2| 524|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 75, isoform a protein. Length = 524 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPL----TPPXPPP 404 P PPP +P PP P PP PP P P +PP PPP Sbjct: 261 PPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPPPPPP 308 Score = 36.3 bits (80), Expect = 0.032 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP +P PP P PPP P P P PP PPP Sbjct: 271 PPPRTGSPPPPPTGSPP-PPPAGGSPPPPRAGSP--PPPPPP 309 Score = 36.3 bits (80), Expect = 0.032 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P PPP +P PP P PPP P P PPP Sbjct: 282 PTGSPPPPPAGGSPPPPRAGSPPPPPPPRGSPPTGSLPPPQAGGSPPP 329 Score = 35.9 bits (79), Expect = 0.042 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -1 Query: 526 PPXPXT--PXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P T P PP P PP PP P P PP PP P Sbjct: 270 PPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPP--PPPPPRGSP 313 Score = 35.5 bits (78), Expect = 0.056 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P PPP P P P PPP P P P PP P P Sbjct: 239 PAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPP 289 Score = 35.1 bits (77), Expect = 0.073 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P PPP P PP P P PP P P T PPP Sbjct: 278 PPPPPTGSPPPPPAGGSPPPPRAGSPPPPPPPRGSPPTGSLPPP 321 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP +P P PP PP P P P PP P Sbjct: 244 PPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPP 290 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PPP PP P PP PP P PP P Sbjct: 295 PPPPRAGSPPPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPPP 339 Score = 28.3 bits (60), Expect = 8.4 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP--XPPPXXP 395 SP PPP PP P PPP P +PP PP P Sbjct: 312 SPPTGSLPPPQAGGSPPPAGTGSPPPPPRQKRQAPERSPPTGSPPTGSPPTGRP 365 >U58751-5|AAN84882.1| 781|Caenorhabditis elegans Wasp (actin cytoskeleton modulator)homolog protein 1, isoform b protein. Length = 781 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP P + + PPP P PP L PP PPP P Sbjct: 611 PPPPPPPQSFGMAPISSAAPPPPPPPPPMGLPAVGAGAPPPPPPPPP 657 Score = 34.7 bits (76), Expect = 0.097 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -1 Query: 523 PXPXTPX--PPXLXPXPXPPPXPXPPXPLXXXXPLT---PPXPPPXXP 395 P P P P P PPP P PP P++ PP PPP P Sbjct: 591 PLPQAPNYGTPENRPHAVPPPPPPPPPQSFGMAPISSAAPPPPPPPPP 638 Score = 34.7 bits (76), Expect = 0.097 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P PPP P P PPP P P PP PPP Sbjct: 609 PPPPPPPPPQSFGMAPISSAAPPPPPPPPPMGLPAVGAGAPPPPPPPP 656 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P PPP P P + PPP P PP + PP Sbjct: 630 PPPPPPPPPMGLPAVGAGAPPPPPPPPPSGAGGPASVLAKLPP 672 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/42 (30%), Positives = 16/42 (38%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP P + + P P P P + PP PPP Sbjct: 574 PPPPPPSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPPPPPP 615 >U58751-4|AAN84881.1| 607|Caenorhabditis elegans Wasp (actin cytoskeleton modulator)homolog protein 1, isoform a protein. Length = 607 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP P + + PPP P PP L PP PPP P Sbjct: 437 PPPPPPPQSFGMAPISSAAPPPPPPPPPMGLPAVGAGAPPPPPPPPP 483 Score = 34.7 bits (76), Expect = 0.097 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -1 Query: 523 PXPXTPX--PPXLXPXPXPPPXPXPPXPLXXXXPLT---PPXPPPXXP 395 P P P P P PPP P PP P++ PP PPP P Sbjct: 417 PLPQAPNYGTPENRPHAVPPPPPPPPPQSFGMAPISSAAPPPPPPPPP 464 Score = 34.7 bits (76), Expect = 0.097 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P PPP P P PPP P P PP PPP Sbjct: 435 PPPPPPPPPQSFGMAPISSAAPPPPPPPPPMGLPAVGAGAPPPPPPPP 482 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P PPP P P + PPP P PP + PP Sbjct: 456 PPPPPPPPPMGLPAVGAGAPPPPPPPPPSGAGGPASVLAKLPP 498 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/42 (30%), Positives = 16/42 (38%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP P + + P P P P + PP PPP Sbjct: 400 PPPPPPSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPPPPPP 441 >AF043706-2|AAB97604.2| 730|Caenorhabditis elegans Hypothetical protein ZC123.1 protein. Length = 730 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXP 446 +P P PP P T PP P PPP P PP P Sbjct: 118 NPGGVPAPPNPPRTCCPPPTPAAPPPPPPPPPPAP 152 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 499 PXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P PP P P P PP PPP Sbjct: 119 PGGVPAPPNPPRTCCPPPTPAAPPPPPPPPPP 150 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P PP P P P PP P PP P P P Sbjct: 119 PGGVPAPPNPPRTCCPPPTPAAPPPPPP--------PPPPAPEAP 155 >U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical protein R04E5.8a protein. Length = 997 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P PP P P P PP P P TPP P P P Sbjct: 151 PPRSPPPRRPPMTPPSPQRRPPRTPPSPEPRNPPRTPPSPIPPPP 195 Score = 37.5 bits (83), Expect = 0.014 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 7/63 (11%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPP----XPXPPXPLXXXXPLTPPXP---PPXXP*XXXIX 377 P PPP P P P PPP P P P P+TPP P PP P Sbjct: 122 PPPPPPPRKSRAGGSSPPPPPPPRVPRTPPPRSPPPRRPPMTPPSPQRRPPRTPPSPEPR 181 Query: 376 NXP 368 N P Sbjct: 182 NPP 184 Score = 31.5 bits (68), Expect = 0.90 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXP 461 P PP P PP P P PPP P Sbjct: 172 PRTPPSPEPRNPPRTPPSPIPPPPP 196 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 6/40 (15%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXP------PPXPXPPXP 446 P P PP P PP P P P PP P PP P Sbjct: 157 PRRPPMTPPSPQR-RPPRTPPSPEPRNPPRTPPSPIPPPP 195 >U40187-5|AAS80343.1| 1437|Caenorhabditis elegans Cytokinesis defect protein 1, isoformb protein. Length = 1437 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P PP L P PP P PP L PP PPP Sbjct: 707 PPITGGPPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPP 748 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 9/51 (17%) Frame = -1 Query: 529 PPPXPXTPXPPXLX-PXPXPPP--------XPXPPXPLXXXXPLTPPXPPP 404 PPP P PP P P PPP P PP P P PP PPP Sbjct: 727 PPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPP 777 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P PP P PPP P PP P PP PPP Sbjct: 752 PPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGP--PPPPPP 790 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P L P PP P PP L PP PPP Sbjct: 717 PGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPP 764 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP P P + P PPP P P+ P PP PPP Sbjct: 726 PPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPP--PPPPPP 765 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPP----XPXPPXPLXXXXPLTPPXPPP 404 P PPP P P P P PPP P PP P PP PPP Sbjct: 742 PPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPP 789 Score = 34.7 bits (76), Expect = 0.097 Identities = 21/52 (40%), Positives = 23/52 (44%), Gaps = 10/52 (19%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPP--------XPXPPXPLXXXXPLT--PPXPPP 404 PPP P P P P P PPP P PP P P++ PP PPP Sbjct: 713 PPPPPGLP-PITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPP 763 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXP----XPPPXPXPPXPLXXXXPLTPPXPPP 404 P PPP P PP P P PP P PP P+ P PP Sbjct: 759 PPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFAPMAPVIPDYLPP 806 >U40187-4|AAS80342.1| 1435|Caenorhabditis elegans Cytokinesis defect protein 1, isoforma protein. Length = 1435 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P PP L P PP P PP L PP PPP Sbjct: 707 PPITGGPPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPP 748 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 9/51 (17%) Frame = -1 Query: 529 PPPXPXTPXPPXLX-PXPXPPP--------XPXPPXPLXXXXPLTPPXPPP 404 PPP P PP P P PPP P PP P P PP PPP Sbjct: 727 PPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPP 777 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P PP P PPP P PP P PP PPP Sbjct: 752 PPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGP--PPPPPP 790 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P L P PP P PP L PP PPP Sbjct: 717 PGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPP 764 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP P P + P PPP P P+ P PP PPP Sbjct: 726 PPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPP--PPPPPP 765 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPP----XPXPPXPLXXXXPLTPPXPPP 404 P PPP P P P P PPP P PP P PP PPP Sbjct: 742 PPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPP 789 Score = 34.7 bits (76), Expect = 0.097 Identities = 21/52 (40%), Positives = 23/52 (44%), Gaps = 10/52 (19%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPP--------XPXPPXPLXXXXPLT--PPXPPP 404 PPP P P P P P PPP P PP P P++ PP PPP Sbjct: 713 PPPPPGLP-PITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPP 763 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXP----XPPPXPXPPXPLXXXXPLTPPXPPP 404 P PPP P PP P P PP P PP P+ P PP Sbjct: 759 PPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFAPMAPVIPDYLPP 806 >AF062008-1|AAC17501.1| 1018|Caenorhabditis elegans unknown protein. Length = 1018 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P PP L P PP P PP L PP PPP Sbjct: 290 PPITGGPPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPP 331 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 9/51 (17%) Frame = -1 Query: 529 PPPXPXTPXPPXLX-PXPXPPP--------XPXPPXPLXXXXPLTPPXPPP 404 PPP P PP P P PPP P PP P P PP PPP Sbjct: 310 PPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPP 360 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P PP P PPP P PP P PP PPP Sbjct: 335 PPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGP--PPPPPP 373 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P L P PP P PP L PP PPP Sbjct: 300 PGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPP 347 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP P P + P PPP P P+ P PP PPP Sbjct: 309 PPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPP--PPPPPP 348 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPP----XPXPPXPLXXXXPLTPPXPPP 404 P PPP P P P P PPP P PP P PP PPP Sbjct: 325 PPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPP 372 Score = 34.7 bits (76), Expect = 0.097 Identities = 21/52 (40%), Positives = 23/52 (44%), Gaps = 10/52 (19%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPP--------XPXPPXPLXXXXPLT--PPXPPP 404 PPP P P P P P PPP P PP P P++ PP PPP Sbjct: 296 PPPPPGLP-PITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPP 346 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXP----XPPPXPXPPXPLXXXXPLTPPXPPP 404 P PPP P PP P P PP P PP P+ P PP Sbjct: 342 PPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFAPMAPVIPDYLPP 389 >Z66565-6|CAA91483.1| 165|Caenorhabditis elegans Hypothetical protein T04F8.8 protein. Length = 165 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -1 Query: 535 PFPPPXPXTPXP-PXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P PPP P P P P P P P P P P P P P P P P Sbjct: 97 PPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAP 142 Score = 35.9 bits (79), Expect = 0.042 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -1 Query: 532 FPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 + PP P P P P P P P P P P P P P P P Sbjct: 95 YVPPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHP 138 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP---PXPLXXXXPLTPP 416 P P P P P P P P P P P P P P P+ P Sbjct: 102 PPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEPIVKP 148 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = -1 Query: 523 PXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P PP P P P P P P P P P P P Sbjct: 92 PQGYVPPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEP 132 >U41557-2|AAA83301.1| 309|Caenorhabditis elegans Hypothetical protein C50F7.5 protein. Length = 309 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP-PXXP 395 P PP P P P P P PP P P P P PP PP P P Sbjct: 206 PSGPPSPG-PVDPSEDPKPSEPPSPGPVDPSDEPSPSDPPGPPGPPGP 252 Score = 34.7 bits (76), Expect = 0.097 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P T P P P PP P P P P PP P P P Sbjct: 84 PSNEPSPGTVAPSD-EPSPSGPPSPGPVNPSEDPQPSGPPSPGPVDP 129 Score = 34.7 bits (76), Expect = 0.097 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PP P P P P P PP P P P PP PP P Sbjct: 223 PSEPPSPG-PVDPSDEPSPSDPPGPPGPPGPPTRRPPGPPGPPTRRP 268 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 508 PXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P PP P P P P PP P P P Sbjct: 197 PVDPSDEPSPSGPPSPGPVDPSEDPKPSEPPSPGPVDP 234 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P P PP P PP P PP P PP PP P Sbjct: 234 PSDEPSPSDPPGPPGPPG-PPTRRPPGPPGPP----TRRPPGPPGPPTRRP 279 Score = 31.9 bits (69), Expect = 0.68 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PP P P P P P P P P P PP P P P Sbjct: 172 PSGPPSPG-PVDPSEDPQPSGSSSPGPVDPSDEPSPSGPPSPGPVDP 217 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -1 Query: 550 SPXXXPFP--PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP 416 +P P P PP P P P P P PP P P P P P Sbjct: 94 APSDEPSPSGPPSPG-PVNPSEDPQPSGPPSPGPVDPSEDPQPSVEP 139 >U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical protein T26C11.2 protein. Length = 343 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/56 (39%), Positives = 25/56 (44%), Gaps = 5/56 (8%) Frame = -1 Query: 556 FXSPXXXPFPPPXP-XTPXP---PXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 F +P P P P P P P P L P P P P P P P P+ P+ P P P Sbjct: 103 FPNPMPFPKPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMLFPKPMPFPKPMP 158 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 F P P P P P L P P P P P P P P+ P P P P Sbjct: 213 FPKPMPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMPKPKPKPKPMPKP 264 Score = 35.9 bits (79), Expect = 0.042 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP---PXPLXXXXPLTPPXPPP 404 P PFP P P P P P P P P P P+ P+ P P P Sbjct: 168 PNPMPFPKPMPKPKPKPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMP 218 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P PFP P P + P P P P P P P P P P P P Sbjct: 12 PKSEPFPKPMPKSKPKSEPFPSPMPFPKPMPKPKPKPKPMPKHKPKPFP 60 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P PFP P P + P P P P P P P P P P P P Sbjct: 148 PKPMPFPKPMPKSKPKSEPFPNPMPFPKPMPKPKPKPKPMPKHKPKPFP 196 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 7/58 (12%) Frame = -1 Query: 556 FXSPXXXPFPPPXP---XTPXP---PXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 F P P P P P P P P L P P P P P P P P+ P P P P Sbjct: 173 FPKPMPKPKPKPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMPKPMPKHKPKPFP 230 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/54 (37%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -1 Query: 556 FXSPXXXPFPPPXP-XTPXP-PXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 F +P P P P P P P P P P P P P P P+ P P P P Sbjct: 167 FPNPMPFPKPMPKPKPKPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMPKP 220 Score = 33.5 bits (73), Expect = 0.22 Identities = 22/62 (35%), Positives = 24/62 (38%), Gaps = 11/62 (17%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXT-PXP-PXLXPXPXPPPXPXP---------PXPLXXXXPLTPPXP 410 F P P P P P P P P L P P P P P P P P+ P+ P P Sbjct: 123 FPKPMLFPKPMPIPKPMPFPKPMLFPKPMPFPKPMPKSKPKSEPFPNPMPFPKPMPKPKP 182 Query: 409 PP 404 P Sbjct: 183 KP 184 Score = 33.1 bits (72), Expect = 0.30 Identities = 21/58 (36%), Positives = 23/58 (39%), Gaps = 7/58 (12%) Frame = -1 Query: 556 FXSPXXXPFPPPXP---XTPXP---PXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 F P P P P P P P P L P P P P P P P+ P+ P P P Sbjct: 37 FPKPMPKPKPKPKPMPKHKPKPFPKPMLFPKPMPKHKPKPFPKPMLFPKPMPFPKPMP 94 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP---PXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P+ P+ P P P Sbjct: 202 PKPMPIPKPMPFPKPMPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMP 252 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP---PXPLXXXXPLTPPXPPP 404 P FP P P P P P P P P P P P P P P P Sbjct: 230 PKPMLFPKPMPIPKPMPFPKPMPKPKPKPKPMPKPKPKLKLKPKPMPFPKP 280 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P L P+ P P P Sbjct: 236 PKPMPIPKPMPFPKPMPKPKPKPKPMPKPKPKLKL-KPKPMPFPKPKP 282 Score = 32.3 bits (70), Expect = 0.52 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP---PXPLXXXXPLTPPXP 410 P PFP P P P P P P P P P P+ P P P Sbjct: 32 PSPMPFPKPMPKPKPKPKPMPKHKPKPFPKPMLFPKPMPKHKPKPFPKP 80 Score = 32.3 bits (70), Expect = 0.52 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 9/57 (15%) Frame = -1 Query: 547 PXXXPFPPPXPXT--PXPPXLXPXPXPPPXPXP-------PXPLXXXXPLTPPXPPP 404 P PFP P P + P P P P P P P P P+ P+ P P P Sbjct: 84 PKPMPFPKPMPKSKPKSEPFPNPMPFPKPKPMPKHKPKPFPKPMLFPKPMPIPKPMP 140 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXT-PXP-PXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 F P P P P P P P P P P P P P P+ P+ P P P Sbjct: 195 FPKPMLFPKPMPIPKPMPFPKPMPKPMPKHKPKPF-PKPMLFPKPMPIPKPMP 246 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 F P P P P P P L P P P P P L P T P P Sbjct: 247 FPKPMPKPKPKPKPMPKPKPKLKLKPKPMPFPKPKPKL---KPKTKPKKNP 294 Score = 29.1 bits (62), Expect = 4.8 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P PFP P P P P P P P P P P+ P P P Sbjct: 26 PKSEPFPSPMPFPKPMPK--PKPKPKPMP-KHKPKPFPKPMLFPKPMP 70 Score = 29.1 bits (62), Expect = 4.8 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXP---XPPXPLXXXXPLTPPXPPPXXP 395 F P P P P P P P P P P P P P+ P P P P Sbjct: 235 FPKPMPIPKPMPFPKPMPKPKPKPKPMPKPKPKLKLKPKPMPFPKP-KPKLKPKTKP 290 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXP 410 F P P P P P P P P P P P P+ P P P Sbjct: 77 FPKPMLFPKPMPFPKPMPKSKPKSEPFPNPMPFPKPKPMPKHKPKPFPKP 126 >AL023835-10|CAA19494.2| 691|Caenorhabditis elegans Hypothetical protein Y37A1B.11 protein. Length = 691 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXP 446 SP P PPP P P P P P P P PP P Sbjct: 541 SPVREPTPPPPPREPTPREPTPEPEPVREPTPPPP 575 Score = 35.1 bits (77), Expect = 0.073 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -1 Query: 511 TPXP-PXLXPXPXPPPX-PXPPXPLXXXXPLTPPXPPPXXP 395 +P P P P P PPP P P P P+ P PPP P Sbjct: 537 SPEPSPVREPTPPPPPREPTPREPTPEPEPVREPTPPPPPP 577 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = -1 Query: 535 PFPPPXPX---TPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P TP PP P P P P P P TPP PPP P Sbjct: 536 PSPEPSPVREPTPPPPPREPTPREP----TPEPEPVREP-TPPPPPPAKP 580 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -1 Query: 487 PXPXPPPXPXPPXPLXXXXPLTP-PXPPP 404 P P PPP P P L P+TP P P P Sbjct: 482 PTPTPPPSPQPVYRLPSPKPVTPEPLPSP 510 >U46675-2|AAB52644.1| 125|Caenorhabditis elegans Hypothetical protein F35A5.5 protein. Length = 125 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 PPP P P P P P P P P P P+ P+ P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 31.9 bits (69), Expect = 0.68 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPL 425 P P P P P P P P P P P P P P+ P+ Sbjct: 4 PIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVPV 45 Score = 31.5 bits (68), Expect = 0.90 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPL 425 P P P P P P P P P P P P P P+ P+ Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPV 43 >AF098500-3|ABD94103.1| 774|Caenorhabditis elegans Temporarily assigned gene nameprotein 343, isoform b protein. Length = 774 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P P P P P P P PP P P+ P PPP P Sbjct: 73 PPLPPPPLP-LSNPPAKPTPPPPPPKPTIRPPPI-PASPPPRPP 114 Score = 35.9 bits (79), Expect = 0.042 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXP-XPPXPLXXXXPLTPPXPPP 404 P PPP PP P PPP P P P+ P PP P Sbjct: 74 PLPPPPLPLSNPPAKPTPPPPPPKPTIRPPPIPASPPPRPPASEP 118 >AF098500-2|AAC67399.2| 996|Caenorhabditis elegans Temporarily assigned gene nameprotein 343, isoform a protein. Length = 996 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P P P P P P P PP P P+ P PPP P Sbjct: 295 PPLPPPPLP-LSNPPAKPTPPPPPPKPTIRPPPI-PASPPPRPP 336 Score = 35.9 bits (79), Expect = 0.042 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXP-XPPXPLXXXXPLTPPXPPP 404 P PPP PP P PPP P P P+ P PP P Sbjct: 296 PLPPPPLPLSNPPAKPTPPPPPPKPTIRPPPIPASPPPRPPASEP 340 >Z68338-7|CAA92756.2| 866|Caenorhabditis elegans Hypothetical protein T24B8.4 protein. Length = 866 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 9/54 (16%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXP------XPPXPLXXXXPLTPP---XPPPXXP 395 PPP P PP P PPP P PP P+ P PP PPP P Sbjct: 66 PPPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPPPP 119 Score = 35.9 bits (79), Expect = 0.042 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = -1 Query: 529 PPPXPX-TPXPPXLXPXPXPPPXP----XPPXPLXXXXPLTPPXPPP 404 PPP P P PP + PPP P PP P P PP PPP Sbjct: 76 PPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAP--PPPPPP 120 Score = 32.3 bits (70), Expect = 0.52 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = -1 Query: 547 PXXXPFPPPX---PXTPXPPXLXPXPXPPPX--PXPPXPLXXXXPLTPPXPPPXXP 395 P P PPP P PP + P PPP PP P + P P P P Sbjct: 80 PGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPPPPPSGLGVAPQPPRPKTP 135 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 7/44 (15%) Frame = -1 Query: 529 PPPXPXT---PXPPXLXPXPXPPPXP----XPPXPLXXXXPLTP 419 PPP P P PP + P PPP P P P P+ P Sbjct: 95 PPPPPMMGGIPPPPPMFGAPPPPPPPSGLGVAPQPPRPKTPVNP 138 >AL032646-7|CAA21680.1| 485|Caenorhabditis elegans Hypothetical protein Y54E2A.8 protein. Length = 485 Score = 35.9 bits (79), Expect = 0.042 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 8/50 (16%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPL--XXXXPLTP------PXPPP 404 PPP P P L P P PPP P P PL P TP P PPP Sbjct: 153 PPPTPIPTPVPILEPPPPPPPVP-PLSPLYKVLEIPATPSPIFVAPLPPP 201 >AC084154-11|AAK29874.1| 350|Caenorhabditis elegans Hypothetical protein Y22D7AR.1 protein. Length = 350 Score = 35.9 bits (79), Expect = 0.042 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 +P P P P P P P P P P P P P P P P P P Sbjct: 162 NPKPEPKPKPKPEPKPKPKPDPKPKPKPKPKPKPKPNPKPEPKPKPKPEP 211 Score = 35.5 bits (78), Expect = 0.056 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P P P Sbjct: 161 PNPKPEPKPKPKPEPKPKPKPDPKPKPKPKPKPKPKPNPKPEPKPKPKP 209 Score = 35.5 bits (78), Expect = 0.056 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P P P Sbjct: 187 PKPKPKPKPKPNPKPEPKPKPKPEPKPKPKPEPKPKPKPKPKPKPKPNP 235 Score = 35.5 bits (78), Expect = 0.056 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 +P P P P P P P P P P P P P P P P P P Sbjct: 198 NPKPEPKPKPKPEPKPKPKPEPKPKPKPKPKPKPKPNPNPKPEPKPKPKP 247 Score = 35.1 bits (77), Expect = 0.073 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P P P Sbjct: 183 PKPKPKPKPKPKPKPNPKPEPKPKPKPEPKPKPKPEPKPKPKPKPKPKP 231 Score = 32.3 bits (70), Expect = 0.52 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P + P P P Sbjct: 219 PKPKPKPKPKPKPKPNPNPKPEPKPKPKPKPKPEPKPKTKLKSEPKPKP 267 Score = 32.3 bits (70), Expect = 0.52 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P P Sbjct: 275 PNPKPEPNPMPELKPKPKHKPNSRPKPNPRPKPKPRSKPNPKPKPRPKP 323 Score = 31.5 bits (68), Expect = 0.90 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P P P P P P P P P L P P P Sbjct: 225 PKPKPKPKPNPNPKPEPKPKPKPKPKPEPKPKTKLKSEPKPKPKLKPKPKP 275 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = -1 Query: 547 PXXXPFPPPXPXT-PXP-PXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P P P P P P P L P P P P P P P + P P P Sbjct: 267 PKLKPKPKPNPKPEPNPMPELKPKPKHKPNSRPKPNPRPKPKPRSKPNPKP 317 >U23515-9|AAP82644.1| 360|Caenorhabditis elegans Hypothetical protein R144.4a protein. Length = 360 Score = 32.3 bits (70), Expect(2) = 0.051 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 475 PPPXPXPPXPLXXXXPLTPPXPPP 404 PPP P PP + P TPP PPP Sbjct: 156 PPPPPPPPVSVPSSKP-TPPPPPP 178 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPP 452 PPP P P PP P P P P PP Sbjct: 155 PPPPP--PPPPVSVPSSKPTPPPPPP 178 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 Query: 472 PPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P PP P+ P + P PPP P Sbjct: 155 PPPPPPPPPVSV--PSSKPTPPPPPP 178 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXP 446 PPP P P PP P P PPP P P Sbjct: 2 PPPPP--PPPP---PPPPPPPAASAPPP 24 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 493 LXPXPXPPPXPXPPXPLXXXXPLTPP 416 + P P PPP P PP P P PP Sbjct: 1 MPPPPPPPPPPPPPPPPAASAP--PP 24 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPP 467 P PPP P P PP PPP Sbjct: 2 PPPPPPPPPPPPPPPPAASAPPP 24 Score = 22.2 bits (45), Expect(2) = 0.051 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = -1 Query: 508 PXPPXLXPXPXPPPXPXP 455 P P P PPP P P Sbjct: 113 PPPTASSAPPVPPPAPVP 130 >Z93393-1|CAB07688.1| 497|Caenorhabditis elegans Hypothetical protein Y48E1B.1 protein. Length = 497 Score = 35.5 bits (78), Expect = 0.056 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXP 446 P P P T PP + P PPP P PP P Sbjct: 334 PSPQPAATPVEITEIPPIISPPAPPPPPPPPPPP 367 Score = 32.7 bits (71), Expect = 0.39 Identities = 16/52 (30%), Positives = 18/52 (34%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 +P PPP P P P P P + P PP PPP P Sbjct: 317 APTTFILPPPPPPMKLDPSPQPAATPVEITEIPPIISPPAPPPPPPPPPPPP 368 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPP 452 PP P PP P P PPP P P Sbjct: 349 PPIISPPAPPPPPPPPPPPPPPQTP 373 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -1 Query: 535 PFPPPXPXTPXP-PXLXPXPXP--PPXPXPPXPLXXXXPLTPPXPPP 404 P PPP P P P P PP PP P P PP PPP Sbjct: 325 PPPPPMKLDPSPQPAATPVEITEIPPIISPPAPPPPPPP--PPPPPP 369 >Z83219-3|CAD57687.1| 965|Caenorhabditis elegans Hypothetical protein C31C9.6 protein. Length = 965 Score = 35.5 bits (78), Expect = 0.056 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P P +P P + P PPP P PP P PP PP Sbjct: 468 PPPSRIPNPSP-SPQPAEVSKSP-PPPPPLPPIATPSSVPPPPPPPP 512 Score = 35.1 bits (77), Expect = 0.073 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 6/50 (12%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXP------PPXPXPPXPLXXXXPLTPPXPPP 404 P PPP P P P P P PP P P P+ + PP PPP Sbjct: 465 PAPPPPSRIPNPS---PSPQPAEVSKSPPPPPPLPPIATPSSVPPPPPPP 511 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 9/54 (16%) Frame = -1 Query: 529 PPPXPX-TPXPPXLXPXPXPPPXPX-------PPXPLXXXX-PLTPPXPPPXXP 395 PP P P PP P P P P P PP PL P + P PPP P Sbjct: 459 PPTTPKPAPPPPSRIPNPSPSPQPAEVSKSPPPPPPLPPIATPSSVPPPPPPPP 512 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -1 Query: 511 TPXPPXLXPXPXPPP-XPXP-PXPLXXXXPLTPPXPPPXXP 395 T P P P PP P P P P +PP PPP P Sbjct: 457 TTPPTTPKPAPPPPSRIPNPSPSPQPAEVSKSPPPPPPLPP 497 >Z78013-1|CAB01425.3| 1140|Caenorhabditis elegans Hypothetical protein F15B9.4 protein. Length = 1140 Score = 35.5 bits (78), Expect = 0.056 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 PPP P P P PPP P PL P PP PP Sbjct: 504 PPPPPLLGIAPMSTNAPPPPPMPGMA-PLSTGAPTPPPPPP 543 Score = 32.7 bits (71), Expect = 0.39 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 13/57 (22%) Frame = -1 Query: 535 PFPPPXPXT--------PXPPXLXPXP----XPPPXPXP-PXPLXXXXPLTPPXPPP 404 P PPP P P PP L P PPP P P PL P TPP PPP Sbjct: 488 PPPPPMPSINGHAPNPPPPPPLLGIAPMSTNAPPPPPMPGMAPLSTGAP-TPPPPPP 543 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P P + P P P PP P+ PP PP Sbjct: 514 PMSTNAPPPPPMPGMAPLSTGAPTPPPPPPVGMANGGPPPPPP 556 Score = 29.9 bits (64), Expect = 2.8 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 9/60 (15%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPL---------XXXXPLTPPXPPPXXP 395 P P P P PP + PP P PP PL P PP PPP P Sbjct: 526 PGMAPLSTGAPTPPPPPPVGMANGGPPPP-PPLPLDLLKGAVAGLKSVPGGPPPPPPPPP 584 >U39666-1|AAA80412.2| 644|Caenorhabditis elegans Nematode astacin protease protein33 protein. Length = 644 Score = 35.5 bits (78), Expect = 0.056 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPX----PPPXPXPPXPLXXXXPLTPPXPPP 404 PPP PP P P PPP PP L PP PPP Sbjct: 41 PPPWHRNRGPPPFGPPPPWDRPPPPWRRPPWHRRPPWGLPPPPPPP 86 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PF PP P PP P PP PP L P PP P P Sbjct: 52 PFGPPPPWDRPPP---PWRRPPWHRRPPWGLPPPPP--PPEPEP 90 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = -1 Query: 556 FXSPXXXPFPPPX----PXTPXPPXLXPXPXPPPXPXP 455 F P PPP P PP P P PPP P P Sbjct: 53 FGPPPPWDRPPPPWRRPPWHRRPPWGLPPPPPPPEPEP 90 >AF535160-1|AAN33048.1| 468|Caenorhabditis elegans UNC-34 protein. Length = 468 Score = 35.5 bits (78), Expect = 0.056 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 9/54 (16%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPP---------PXPXPPXPLXXXXPLTPPXPPPXXP 395 PPP P T P P P PP PP PL PP PPP P Sbjct: 202 PPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPP 255 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P PPP P P + PPP P PP P PP PP Sbjct: 212 PQAPPAPPP-PIGGIAP-VNAHGAPPPPPLPPVGAGAPPPPPPPPPP 256 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 472 PPXPXPPXPLXXXXPLTPPXPPP 404 P P PP PL P PP PPP Sbjct: 198 PHAPPPPVPLTSNIPQAPPAPPP 220 Score = 31.5 bits (68), Expect = 0.90 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -1 Query: 517 PXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLT---PPXPPPXXP 395 P P PP P P PP P+ P+ P PPP P Sbjct: 198 PHAPPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPP 241 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPL 443 PP P P PP P PPP P PP L Sbjct: 234 PPPP--PLPPVGAGAPPPPPPPPPPAQL 259 >AC025722-6|AAO12398.1| 310|Caenorhabditis elegans Uncoordinated protein 34, isoform b protein. Length = 310 Score = 35.5 bits (78), Expect = 0.056 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 9/54 (16%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPP---------PXPXPPXPLXXXXPLTPPXPPPXXP 395 PPP P T P P P PP PP PL PP PPP P Sbjct: 188 PPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPP 241 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P PPP P P + PPP P PP P PP PP Sbjct: 198 PQAPPAPPP-PIGGIAP-VNAHGAPPPPPLPPVGAGAPPPPPPPPPP 242 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 472 PPXPXPPXPLXXXXPLTPPXPPP 404 P P PP PL P PP PPP Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPPP 206 Score = 31.5 bits (68), Expect = 0.90 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -1 Query: 517 PXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLT---PPXPPPXXP 395 P P PP P P PP P+ P+ P PPP P Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPP 227 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPL 443 PP P P PP P PPP P PP L Sbjct: 220 PPPP--PLPPVGAGAPPPPPPPPPPAQL 245 >AC025722-5|AAO12397.1| 454|Caenorhabditis elegans Uncoordinated protein 34, isoform a protein. Length = 454 Score = 35.5 bits (78), Expect = 0.056 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 9/54 (16%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPP---------PXPXPPXPLXXXXPLTPPXPPPXXP 395 PPP P T P P P PP PP PL PP PPP P Sbjct: 188 PPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPP 241 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P PPP P P + PPP P PP P PP PP Sbjct: 198 PQAPPAPPP-PIGGIAP-VNAHGAPPPPPLPPVGAGAPPPPPPPPPP 242 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 472 PPXPXPPXPLXXXXPLTPPXPPP 404 P P PP PL P PP PPP Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPPP 206 Score = 31.5 bits (68), Expect = 0.90 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -1 Query: 517 PXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLT---PPXPPPXXP 395 P P PP P P PP P+ P+ P PPP P Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPP 227 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPL 443 PP P P PP P PPP P PP L Sbjct: 220 PPPP--PLPPVGAGAPPPPPPPPPPAQL 245 >Z48367-5|CAE54886.1| 993|Caenorhabditis elegans Hypothetical protein C33B4.3b protein. Length = 993 Score = 35.1 bits (77), Expect = 0.073 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPP---PXPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP P P + PP P PP PL PP PPP P Sbjct: 767 PPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPPLPPISSGAPPPPPPPPP 816 Score = 32.7 bits (71), Expect = 0.39 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPX----PXPPXPLXXXXPLTPPXPPPXXP 395 P PPP P P + PP P PP PL PP PPP P Sbjct: 766 PPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPPLPPISSGAPP-PPPPPP 815 Score = 32.3 bits (70), Expect = 0.52 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPL 443 F P PPP P P PP P PPP P PP L Sbjct: 785 FTPPSTSSVPPPPP--PLPPISSGAPPPPPPP-PPGGL 819 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 11/58 (18%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXP--------LXXXXPLT---PPXPPPXXP 395 P P TP P PPP P PP P + P T PP PPP P Sbjct: 745 PSLPRSASTPQPIQQQQSSIPPPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPPLPP 802 >Z48367-4|CAA88324.1| 1110|Caenorhabditis elegans Hypothetical protein C33B4.3a protein. Length = 1110 Score = 35.1 bits (77), Expect = 0.073 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPP---PXPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP P P + PP P PP PL PP PPP P Sbjct: 767 PPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPPLPPISSGAPPPPPPPPP 816 Score = 32.7 bits (71), Expect = 0.39 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPX----PXPPXPLXXXXPLTPPXPPPXXP 395 P PPP P P + PP P PP PL PP PPP P Sbjct: 766 PPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPPLPPISSGAPP-PPPPPP 815 Score = 32.3 bits (70), Expect = 0.52 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPL 443 F P PPP P P PP P PPP P PP L Sbjct: 785 FTPPSTSSVPPPPP--PLPPISSGAPPPPPPP-PPGGL 819 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 11/58 (18%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXP--------LXXXXPLT---PPXPPPXXP 395 P P TP P PPP P PP P + P T PP PPP P Sbjct: 745 PSLPRSASTPQPIQQQQSSIPPPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPPLPP 802 >AF016448-12|AAB65959.1| 316|Caenorhabditis elegans Hypothetical protein F41E6.11 protein. Length = 316 Score = 35.1 bits (77), Expect = 0.073 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXP--XPPPXPXPPXPLXXXXPLTPPXPPP 404 P PP P PP P P P P PP + P+ PP P P Sbjct: 40 PCPPQYAPLPPPPMPAPAPAYNPYPCANPPCIVVEPMPVAPPAPAP 85 Score = 29.9 bits (64), Expect = 2.8 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 10/61 (16%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLX-PXPXPP-----PXPX-PPXPLXXXXPL---TPPXPPPXX 398 P P PPP P P P PP P P PP P P TPP P P Sbjct: 43 PQYAPLPPPPMPAPAPAYNPYPCANPPCIVVEPMPVAPPAPAPAYNPYPCATPPCPLPYI 102 Query: 397 P 395 P Sbjct: 103 P 103 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = -1 Query: 535 PFPPPXPXT---PXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP 416 P P P P P PP P P PPP P P PP Sbjct: 28 PCPEPMPVCATPPCPPQYAPLP-PPPMPAPAPAYNPYPCANPP 69 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P P P P P P PP P+ P P P P Sbjct: 27 PPCPE-PMPVCATPPCPPQYAPLPPPPMPAPAPAYNPYPCANPP 69 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 +P P+P P P P P P P P P PP PPP Sbjct: 84 APAYNPYPCATPPCPLP--YIPEPV-APVPAPAPVYEPYACAAPPCPPP 129 >AF106580-3|AAC78205.1| 881|Caenorhabditis elegans Temporarily assigned gene nameprotein 268 protein. Length = 881 Score = 34.7 bits (76), Expect = 0.097 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP 416 PPP P P PP + PP P PP P P PP Sbjct: 67 PPPPP--PPPPLISILQQAPPPPPPPPPPTLKAPPPPP 102 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 472 PPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P PP PL PP PPP P Sbjct: 67 PPPPPPPPPLISILQQAPPPPPPPPP 92 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 481 PXPPPXPXPPXPLXXXXPLTPPXPPP 404 P PPP P P + P PP PPP Sbjct: 67 PPPPPPPPPLISILQQAPPPPPPPPP 92 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXP---XPPXP 446 P PPP P P P PPP P PP P Sbjct: 69 PPPPPPPLISILQQAPPPPPPPPPPTLKAPPPP 101 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = -1 Query: 475 PPPXPXPPXP--LXXXXPLTPPXPPP 404 PPP P PP L P PP PPP Sbjct: 68 PPPPPPPPLISILQQAPPPPPPPPPP 93 >AC025716-21|AAT39978.1| 586|Caenorhabditis elegans Hypothetical protein Y39G10AR.18b protein. Length = 586 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 532 FPPPXPXTPXPPXLXPXPXPPPXPXPPXP 446 F PP P P + P P PPP P P P Sbjct: 262 FGPPLAHLPAPVAIYPTPPPPPAPAPAAP 290 >AC025716-20|AAT39977.2| 946|Caenorhabditis elegans Hypothetical protein Y39G10AR.18a protein. Length = 946 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 532 FPPPXPXTPXPPXLXPXPXPPPXPXPPXP 446 F PP P P + P P PPP P P P Sbjct: 622 FGPPLAHLPAPVAIYPTPPPPPAPAPAAP 650 >Z82083-3|CAB04971.1| 756|Caenorhabditis elegans Hypothetical protein ZK1010.5 protein. Length = 756 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP 416 P P T P L P P PPP P P P+TPP Sbjct: 625 PVDPVTEASP-LNPQPPPPPSPSPEPEPEPKPPVTPP 660 >Z70309-6|CAA94360.1| 324|Caenorhabditis elegans Hypothetical protein R102.6 protein. Length = 324 Score = 33.1 bits (72), Expect = 0.30 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXP 410 PPP P PP P P P P P PP P+T P Sbjct: 244 PPPSPVCMPPPP-PPCPMPIPCPPPPPACSCPPPVTMYQP 282 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -1 Query: 493 LXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 L P P P P PP P P PP P P Sbjct: 242 LPPPPSPVCMPPPPPPCPMPIPCPPPPPACSCP 274 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 SP P PP P P P P P PPP P P+ P P P Sbjct: 247 SPVCMP--PPPPPCPMP---IPCPPPPPACSCPPPVTMYQPCMVPQYVP 290 >Z79596-1|CAB01857.1| 830|Caenorhabditis elegans Hypothetical protein C02C6.1a protein. Length = 830 Score = 32.7 bits (71), Expect = 0.39 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 5/56 (8%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPL-----XXXXPLTPPXPPPXXP 395 P P PP P PP P PPP PP PL P P P P Sbjct: 767 PRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPPPGAPGGGGGMYPPLIPTRPGPGGP 822 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 529 PPPXPXTPXPPX-LXPXPXPPPXPXPPXPLXXXXPLT--PPXPPP 404 PPP P + P P P P P P PP P P PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPP 792 >L29031-1|AAB72228.2| 830|Caenorhabditis elegans dynamin protein. Length = 830 Score = 32.7 bits (71), Expect = 0.39 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 5/56 (8%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPL-----XXXXPLTPPXPPPXXP 395 P P PP P PP P PPP PP PL P P P P Sbjct: 767 PRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPPPGAPGGGGGMYPPLIPTRPGPGGP 822 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 529 PPPXPXTPXPPX-LXPXPXPPPXPXPPXPLXXXXPLT--PPXPPP 404 PPP P + P P P P P P PP P P PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPP 792 >AF025467-5|AAB71038.2| 1115|Caenorhabditis elegans Hypothetical protein R148.3a protein. Length = 1115 Score = 32.7 bits (71), Expect = 0.39 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXP-----XPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P P + P P PPP P PP P P P P Sbjct: 351 PAPTPAPAPAEDPVVTPAPEELTTPPPPAPPPPAPAVPEEAQAPTPAPEEAP 402 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -1 Query: 550 SPXXXPFPPPXPX-TPXPPXLXPXPXP-PPXPXPPXPLXXXXPLTPPXPPP 404 +P P P P TP P L P P PP P P P P P P Sbjct: 352 APTPAPAPAEDPVVTPAPEELTTPPPPAPPPPAPAVPEEAQAPTPAPEEAP 402 >AC006651-1|AAF39870.4| 1138|Caenorhabditis elegans Hypothetical protein H06I04.5 protein. Length = 1138 Score = 32.7 bits (71), Expect = 0.39 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PP P P P P P P P P P P P P PP P Sbjct: 668 PSSSEVPPAEPSAPEPKPA-PKPDPKPDP-KPDPKPDPVPAKPVSPPVIVP 716 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P+ P P Sbjct: 681 PEPKPAPKPDPKPDPKPDPKPDPVPAKPVSPPVIVPIDSIVPAP 724 >Z74472-4|CAA98942.1| 301|Caenorhabditis elegans Hypothetical protein F23H12.4 protein. Length = 301 Score = 32.3 bits (70), Expect = 0.52 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P TP P + P P P P P P PP P Sbjct: 122 PGAPGTPGTPGKPPVAPCEPTTPPPCKPCPQGPPGPPGPPGAP 164 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P TP P P P PP P PP PP Sbjct: 119 PGRPGAPGTPGTPGKPPVAPCEPTTPPPCKPCPQGPPGPPGPP 161 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P PP P PP P P P P P PP PP Sbjct: 228 PPGPPGPPGAPGNDGPPG---PPGPKGAPGPDGPPGVDGQSGPPGPP 271 >Z73910-4|CAA98136.1| 662|Caenorhabditis elegans Hypothetical protein M117.4 protein. Length = 662 Score = 32.3 bits (70), Expect = 0.52 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 F P P P P P P P P P P PL P T P P Sbjct: 143 FEKPNLEPGKPEKPEKLDKPLAKPLPPPSAAPPPVAPLSAPVPSTGAPPSAVPP 196 >V00147-1|CAA23463.1| 296|Caenorhabditis elegans protein ( Caenorhabditis elegansgene Col-1 coding for a collagen. ). Length = 296 Score = 32.3 bits (70), Expect = 0.52 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P TP P + P P P P P P PP P Sbjct: 117 PGAPGTPGTPGKPPVAPCEPTTPPPCKPCPQGPPGPPGPPGAP 159 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P TP P P P PP P PP PP Sbjct: 114 PGRPGAPGTPGTPGKPPVAPCEPTTPPPCKPCPQGPPGPPGPP 156 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P PP P PP P P P P P PP PP Sbjct: 223 PPGPPGPPGAPGNDGPPG---PPGPKGAPGPDGPPGADGQSGPPGPP 266 >U23515-8|AAP82645.1| 362|Caenorhabditis elegans Hypothetical protein R144.4b protein. Length = 362 Score = 32.3 bits (70), Expect = 0.52 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 475 PPPXPXPPXPLXXXXPLTPPXPPP 404 PPP P PP + P TPP PPP Sbjct: 156 PPPPPPPPVSVPSSKP-TPPPPPP 178 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPP 452 PPP P P PP P P P P PP Sbjct: 155 PPPPP--PPPPVSVPSSKPTPPPPPP 178 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 Query: 472 PPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P PP P+ P + P PPP P Sbjct: 155 PPPPPPPPPVSV--PSSKPTPPPPPP 178 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXP 446 PPP P P PP P P PPP P P Sbjct: 2 PPPPP--PPPP---PPPPPPPAASAPPP 24 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 493 LXPXPXPPPXPXPPXPLXXXXPLTPP 416 + P P PPP P PP P P PP Sbjct: 1 MPPPPPPPPPPPPPPPPAASAP--PP 24 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPP 467 P PPP P P PP PPP Sbjct: 2 PPPPPPPPPPPPPPPPAASAPPP 24 >J01047-1|AAA27988.1| 296|Caenorhabditis elegans protein ( C.elegans (nematode)collagen 1 (col-1) gene, complete cds. ). Length = 296 Score = 32.3 bits (70), Expect = 0.52 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P TP P + P P P P P P PP P Sbjct: 117 PGAPGTPGTPGKPPVAPCEPTTPPPCKPCPQGPPGPPGPPGAP 159 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P TP P P P PP P PP PP Sbjct: 114 PGRPGAPGTPGTPGKPPVAPCEPTTPPPCKPCPQGPPGPPGPP 156 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P PP P PP P P P P P PP PP Sbjct: 223 PPGPPGPPGAPGNDGPPG---PPGPKGAPGPDGPPGADGQSGPPGPP 266 >Z73102-2|CAB63428.1| 341|Caenorhabditis elegans Hypothetical protein B0035.1b protein. Length = 341 Score = 31.9 bits (69), Expect = 0.68 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P PP P PPP PP P + PP P P Sbjct: 143 PPMPSGMMPPRGMPGAYPPPRGYPPAPAPGVY-MPPPGMPGAYP 185 Score = 31.9 bits (69), Expect = 0.68 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = -1 Query: 532 FPPPX--PXTPXPPXLXPXP-XPPPXPXPPXPLXXXXPLTPPXPPP 404 +PPP P P P P P P P P P+ P PP P P Sbjct: 159 YPPPRGYPPAPAPGVYMPPPGMPGAYPPPRMPIGHGPPGGPPMPGP 204 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = -1 Query: 547 PXXXPFP--PPXPXTPXPPXL-XPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PFP PP P P PP + P P PP + P PP P Sbjct: 118 PQHFPFPGMPPMPSGPPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGYPPAPAP 171 Score = 29.1 bits (62), Expect = 4.8 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -1 Query: 526 PPXPXTPXP-PXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P TP P P P P PP P P P + PP P P Sbjct: 109 PPMP-TPMPFPQHFPFPGMPPMPSGPPPPSMAYGM-PPMPSGMMP 151 >Z73102-1|CAA97419.1| 298|Caenorhabditis elegans Hypothetical protein B0035.1a protein. Length = 298 Score = 31.9 bits (69), Expect = 0.68 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P PP P PPP PP P + PP P P Sbjct: 143 PPMPSGMMPPRGMPGAYPPPRGYPPAPAPGVY-MPPPGMPGAYP 185 Score = 31.9 bits (69), Expect = 0.68 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = -1 Query: 532 FPPPX--PXTPXPPXLXPXP-XPPPXPXPPXPLXXXXPLTPPXPPP 404 +PPP P P P P P P P P P+ P PP P P Sbjct: 159 YPPPRGYPPAPAPGVYMPPPGMPGAYPPPRMPIGHGPPGGPPMPGP 204 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = -1 Query: 547 PXXXPFP--PPXPXTPXPPXL-XPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PFP PP P P PP + P P PP + P PP P Sbjct: 118 PQHFPFPGMPPMPSGPPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGYPPAPAP 171 Score = 29.1 bits (62), Expect = 4.8 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -1 Query: 526 PPXPXTPXP-PXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P TP P P P P PP P P P + PP P P Sbjct: 109 PPMP-TPMPFPQHFPFPGMPPMPSGPPPPSMAYGM-PPMPSGMMP 151 >Z34533-1|CAA84302.3| 730|Caenorhabditis elegans Hypothetical protein B0285.1 protein. Length = 730 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXP 446 PPP P P + P P PPP P P Sbjct: 206 PPPPPLPPNSQFMTPPPRPPPAPFSIPP 233 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P P PPP P PP +TPP PP P Sbjct: 189 PPPPSFNINPFQPMFSQPPPPPLPPNSQF----MTPPPRPPPAP 228 >U67967-1|AAC47829.1| 413|Caenorhabditis elegans PTL-1B protein protein. Length = 413 Score = 31.9 bits (69), Expect = 0.68 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP-XPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEP 86 Score = 31.5 bits (68), Expect = 0.90 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP---XPPXPLXXXXPLTPPXPPP 404 P P P P P P + P P P P P P P P P P P Sbjct: 50 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVP 100 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPL 443 P P P P P P P P P P P P P P+ Sbjct: 78 PEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPV 113 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -1 Query: 526 PPXPXTPXP-PXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP 74 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 56 PEPEPEPKPKPEVEPVPQPEPEPEYQPEP-EPEPEVEPEPEPEPVPEP 102 >U67966-1|AAB97090.1| 453|Caenorhabditis elegans PTL-1A protein protein. Length = 453 Score = 31.9 bits (69), Expect = 0.68 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP-XPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEP 86 Score = 31.5 bits (68), Expect = 0.90 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP---XPPXPLXXXXPLTPPXPPP 404 P P P P P P + P P P P P P P P P P P Sbjct: 50 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVP 100 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPL 443 P P P P P P P P P P P P P P+ Sbjct: 78 PEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPV 113 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -1 Query: 526 PPXPXTPXP-PXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP 74 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 56 PEPEPEPKPKPEVEPVPQPEPEPEYQPEP-EPEPEVEPEPEPEPVPEP 102 >U38983-1|AAA80687.1| 436|Caenorhabditis elegans TAU-1b protein. Length = 436 Score = 31.9 bits (69), Expect = 0.68 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP-XPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P P Sbjct: 16 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEP 64 Score = 31.5 bits (68), Expect = 0.90 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP---XPPXPLXXXXPLTPPXPPP 404 P P P P P P + P P P P P P P P P P P Sbjct: 28 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVP 78 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPL 443 P P P P P P P P P P P P P P+ Sbjct: 56 PEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPV 91 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -1 Query: 526 PPXPXTPXP-PXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 10 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP 52 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 34 PEPEPEPKPKPEVEPVPQPEPEPEYQPEP-EPEPEVEPEPEPEPVPEP 80 >U38982-1|AAA80686.1| 431|Caenorhabditis elegans TAU-1a protein. Length = 431 Score = 31.9 bits (69), Expect = 0.68 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP-XPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P P Sbjct: 16 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEP 64 Score = 31.5 bits (68), Expect = 0.90 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP---XPPXPLXXXXPLTPPXPPP 404 P P P P P P + P P P P P P P P P P P Sbjct: 28 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVP 78 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPL 443 P P P P P P P P P P P P P P+ Sbjct: 56 PEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPV 91 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -1 Query: 526 PPXPXTPXP-PXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 10 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP 52 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 34 PEPEPEPKPKPEVEPVPQPEPEPEYQPEP-EPEPEVEPEPEPEPVPEP 80 >U00051-4|AAK70645.1| 453|Caenorhabditis elegans Protein with tau-like repeats protein1, isoform a protein. Length = 453 Score = 31.9 bits (69), Expect = 0.68 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP-XPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEP 86 Score = 31.5 bits (68), Expect = 0.90 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP---XPPXPLXXXXPLTPPXPPP 404 P P P P P P + P P P P P P P P P P P Sbjct: 50 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVP 100 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPL 443 P P P P P P P P P P P P P P+ Sbjct: 78 PEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPV 113 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -1 Query: 526 PPXPXTPXP-PXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP 74 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 56 PEPEPEPKPKPEVEPVPQPEPEPEYQPEP-EPEPEVEPEPEPEPVPEP 102 >U00051-3|AAK70647.1| 413|Caenorhabditis elegans Protein with tau-like repeats protein1, isoform c protein. Length = 413 Score = 31.9 bits (69), Expect = 0.68 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP-XPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEP 86 Score = 31.5 bits (68), Expect = 0.90 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP---XPPXPLXXXXPLTPPXPPP 404 P P P P P P + P P P P P P P P P P P Sbjct: 50 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVP 100 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPL 443 P P P P P P P P P P P P P P+ Sbjct: 78 PEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPV 113 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -1 Query: 526 PPXPXTPXP-PXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP 74 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 56 PEPEPEPKPKPEVEPVPQPEPEPEYQPEP-EPEPEVEPEPEPEPVPEP 102 >U00051-2|AAK70646.1| 458|Caenorhabditis elegans Protein with tau-like repeats protein1, isoform b protein. Length = 458 Score = 31.9 bits (69), Expect = 0.68 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP-XPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEP 86 Score = 31.5 bits (68), Expect = 0.90 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXP---XPPXPLXXXXPLTPPXPPP 404 P P P P P P + P P P P P P P P P P P Sbjct: 50 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVP 100 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPL 443 P P P P P P P P P P P P P P+ Sbjct: 78 PEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPV 113 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -1 Query: 526 PPXPXTPXP-PXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP 74 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P P Sbjct: 56 PEPEPEPKPKPEVEPVPQPEPEPEYQPEP-EPEPEVEPEPEPEPVPEP 102 >Z77662-5|CAB01192.2| 579|Caenorhabditis elegans Hypothetical protein F47B8.5 protein. Length = 579 Score = 31.5 bits (68), Expect = 0.90 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P P P P P P P P P P P Sbjct: 483 PAPAPAPAPAPAPEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEPAP 530 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPPXXP 395 +P P P P P P P P P P P P P P P P Sbjct: 476 APAAPAEPAPAPAPAPAPAPEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEP 528 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXP-XPPXPLXXXXPLTPPXPPPXXP 395 +P P P P P P P P P P P P P P P P Sbjct: 484 APAPAPAPAPAPEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEPAPVPEVAP 536 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = -1 Query: 550 SPXXXPFPPPXPX-TPXP-PXLXPXPXPPPXPXPPXPLXXXXPLTPPXP 410 +P P P P P P P P P P P P P+ P P P Sbjct: 494 APEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEPAPVPEVAPAPAPAP 542 >Z69658-1|CAA93481.1| 418|Caenorhabditis elegans Hypothetical protein C36H8.1 protein. Length = 418 Score = 31.5 bits (68), Expect = 0.90 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P PP P P P P P P P P+ P P P Sbjct: 180 PRPPPQEPPKPVEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAPPPAP 227 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXP----PXPLXXXXPLTPPXPPP 404 P P P P P P P PPP P P P P+ PPP Sbjct: 178 PPPRPPPQEPPKPVEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAPPP 225 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -1 Query: 487 PXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P PP PP P+ P PP P P Sbjct: 177 PPPPRPPPQEPPKPVEQAAPPPPPAPMP 204 Score = 29.1 bits (62), Expect = 4.8 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P PPP P P P P P P P P P+ P P P P Sbjct: 196 PPPPPAP-MPVPVEKAPEPVPAPVEQIAPP---PAPVQDPAPAPVEP 238 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -1 Query: 475 PPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PPP P P P PP PP P Sbjct: 178 PPPRPPPQEPPKPVEQAAPPPPPAPMP 204 >AC006708-23|AAF60414.1| 975|Caenorhabditis elegans Paz/piwi domain-containing protein2 protein. Length = 975 Score = 31.5 bits (68), Expect = 0.90 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPL 443 PP P PP P PP P PP P+ Sbjct: 12 PPVPPVGFPPVTAPPGLHPPPPVPPVPV 39 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -1 Query: 535 PFPPPX-PXTPXPPXLXPXPXPPPXPXPPXPL 443 P PP P PP L P P PP P P P+ Sbjct: 13 PVPPVGFPPVTAPPGLHPPPPVPPVPVPTLPV 44 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 PP P PP P PP PP P+ PP P P P Sbjct: 7 PPVTMPPVPPVGFPPVTAPPGLHPPPPV-------PPVPVPTLP 43 >Z98866-8|CAB11562.2| 425|Caenorhabditis elegans Hypothetical protein Y49E10.10 protein. Length = 425 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P T PP PPP P P P T PPP Sbjct: 175 PPPPTTKAPPPPTTKAPPPPTTKAPPP-----PTTKAPPPP 210 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP*XXXIXNXP 368 P PPP PP P PP PP P T P P N P Sbjct: 177 PPTTKAPPPPTTKAPPPPTTKAPPPPTTKAPPPPTTNKEVTTVAPVPKPAPVTAPAPNPP 236 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/48 (33%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPX----PLXXXXPLTPPXPPPXXP 395 PP P T PP PPP P+ P+T P P P P Sbjct: 191 PPPPTTKAPPPPTTKAPPPPTTNKEVTTVAPVPKPAPVTAPAPNPPAP 238 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P P PP P P+ P PPP Sbjct: 225 PAPVTAPAPNPPAPENTTAKVETTKPTKAAPPAPTPVPNPVPSPPPPP 272 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP 416 PPP PP P PP PP P P PP Sbjct: 175 PPPPTTKAPPPPTTKAPPPPTTKAPPPPTTKAPP--PP 210 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = -1 Query: 523 PXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P PP P P PP P T PPP Sbjct: 170 PTTEAPPPPTTKAPPPPTTKAPPPPTTKAPPPPTTKAPPP 209 >Z69360-4|CAC42291.2| 732|Caenorhabditis elegans Hypothetical protein F25H8.5c protein. Length = 732 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXP 428 P PPP P P P P P P PP P P Sbjct: 97 PRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYP 136 Score = 28.3 bits (60), Expect = 8.4 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P P L P P PPP P P P PP P Sbjct: 88 PQPTPGPPPPRNNCL-PPPGPPP-PCQQYQQPQPPPCQRPQPPQPQP 132 >Z69360-3|CAA93286.2| 369|Caenorhabditis elegans Hypothetical protein F25H8.5b protein. Length = 369 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXP 428 P PPP P P P P P P PP P P Sbjct: 97 PRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYP 136 Score = 28.3 bits (60), Expect = 8.4 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P P L P P PPP P P P PP P Sbjct: 88 PQPTPGPPPPRNNCL-PPPGPPP-PCQQYQQPQPPPCQRPQPPQPQP 132 >Z69360-2|CAA93285.2| 780|Caenorhabditis elegans Hypothetical protein F25H8.5a protein. Length = 780 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXP 428 P PPP P P P P P P PP P P Sbjct: 97 PRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYP 136 Score = 28.3 bits (60), Expect = 8.4 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P P L P P PPP P P P PP P Sbjct: 88 PQPTPGPPPPRNNCL-PPPGPPP-PCQQYQQPQPPPCQRPQPPQPQP 132 >U53333-2|AAA96155.1| 299|Caenorhabditis elegans Collagen protein 34 protein. Length = 299 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P P P P P P P P P PP PP Sbjct: 120 PGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGPP 162 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 4/55 (7%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPX-PPPXPXPPX--PLXXXXPLTPPXPP-PXXP 395 P P P P P P L P PP P P P P PP PP P P Sbjct: 107 PAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGP 161 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 PP P P PP P P P P PP PP Sbjct: 152 PPGPPGPPGPPGDSGEPGSPGLPGQDAAPGEPGPKGPPGPP 192 >M80650-1|AAA27985.1| 298|Caenorhabditis elegans alpha-collagen protein. Length = 298 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P P P P P P P P P PP PP Sbjct: 120 PGAPGLPGNPGRPPQQPCEPITPPPWKPCPQGPPGPPGPPGPP 162 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 4/55 (7%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPX-PPPXPXPPX--PLXXXXPLTPPXPP-PXXP 395 P P P P P P L P PP P P P P PP PP P P Sbjct: 107 PAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPWKPCPQGPPGPPGPPGP 161 >AL110490-7|CAD59175.1| 533|Caenorhabditis elegans Hypothetical protein Y48B6A.6b protein. Length = 533 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -1 Query: 511 TPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 +P PP + P PPP P P P +PP P P Sbjct: 253 SPVPPPVLSIP-PPPPPNIPLPTIPQEVQSPPSPRP 287 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -1 Query: 535 PFPPPX-PXTPXPPXLXPXPX-PPPXPXPPXPLXXXXPLTPPXPPP 404 P PPP P PP P P P PP P P PP P P Sbjct: 254 PVPPPVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVP--PPIPSP 297 >AL110490-6|CAB54442.2| 687|Caenorhabditis elegans Hypothetical protein Y48B6A.6a protein. Length = 687 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -1 Query: 511 TPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 +P PP + P PPP P P P +PP P P Sbjct: 253 SPVPPPVLSIP-PPPPPNIPLPTIPQEVQSPPSPRP 287 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -1 Query: 535 PFPPPX-PXTPXPPXLXPXPX-PPPXPXPPXPLXXXXPLTPPXPPP 404 P PPP P PP P P P PP P P PP P P Sbjct: 254 PVPPPVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVP--PPIPSP 297 >AL033536-4|CAA22144.2| 1582|Caenorhabditis elegans Hypothetical protein Y53C10A.10 protein. Length = 1582 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = -1 Query: 502 PPXLXPXPXPPPXPXP-PXPLXXXXPLTPPXPPPXXP 395 PP P P P P P P P P P P P P P Sbjct: 927 PPIPVPNPIPKPNPGPGPGPPSPNGPSDPNKPSPNGP 963 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP*XXXIXNX 371 +P P P P P P P P P P P P P P P P P N Sbjct: 933 NPIPKPNPGPGPGPPSPN--GPSDPNKPSPNGPSPNGPNGPSDPNKPGPSGPNGPSDPNK 990 Query: 370 P 368 P Sbjct: 991 P 991 Score = 28.7 bits (61), Expect = 6.4 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -1 Query: 532 FPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP*XXXIXNXP 368 F PP P P P P P P P P P P +P P P P N P Sbjct: 925 FIPPIPVPNPIPKPNPGPGPGP-PSPNGPSDPNKP-SPNGPSPNGPNGPSDPNKP 977 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPX-PXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P P P P P P P P P P P P P Sbjct: 949 PNGPSDPNKPSPNGPSPNGPNGPSDPNKPGPSGPNGPSDPNKPSPNGP 996 >AF410845-1|AAL76233.1| 299|Caenorhabditis elegans cuticular collagen RAM-4 protein. Length = 299 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P P P P P P P P P PP PP Sbjct: 120 PGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGPP 162 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 4/55 (7%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPX-PPPXPXPPX--PLXXXXPLTPPXPP-PXXP 395 P P P P P P L P PP P P P P PP PP P P Sbjct: 107 PAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGP 161 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 PP P P PP P P P P PP PP Sbjct: 152 PPGPPGPPGPPGDSGEPGSPGLPGQDAAPGEPGPKGPPGPP 192 >AC006611-4|AAK85456.2| 328|Caenorhabditis elegans Hypothetical protein C30F8.3 protein. Length = 328 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 502 PPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P L P PPP P P P PP PPP P Sbjct: 49 PAALYSAPVPPPPAYPFAPQVFTQP-PPPPPPPVLP 83 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXP 461 P PPP P P P + P PPP P Sbjct: 56 PVPPP-PAYPFAPQVFTQPPPPPPP 79 >Z82269-5|CAH60772.1| 618|Caenorhabditis elegans Hypothetical protein Y45F10B.13b protein. Length = 618 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 508 PXPPXLXPXPXPPPXPXPPXPL 443 P PP P PPP P PP P+ Sbjct: 241 PEPPREKSVPPPPPPPPPPKPV 262 Score = 24.6 bits (51), Expect(2) = 7.1 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 429 P*PPPXPPPXPL 394 P PPP PPP P+ Sbjct: 251 PPPPPPPPPKPV 262 Score = 22.2 bits (45), Expect(2) = 7.1 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -2 Query: 558 PXXPLXFXLSPPPXPXPP 505 P P + PPP P PP Sbjct: 241 PEPPREKSVPPPPPPPPP 258 >Z82269-4|CAB70200.2| 633|Caenorhabditis elegans Hypothetical protein Y45F10B.13a protein. Length = 633 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 508 PXPPXLXPXPXPPPXPXPPXPL 443 P PP P PPP P PP P+ Sbjct: 256 PEPPREKSVPPPPPPPPPPKPV 277 Score = 24.6 bits (51), Expect(2) = 7.1 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 429 P*PPPXPPPXPL 394 P PPP PPP P+ Sbjct: 266 PPPPPPPPPKPV 277 Score = 22.2 bits (45), Expect(2) = 7.1 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -2 Query: 558 PXXPLXFXLSPPPXPXPP 505 P P + PPP P PP Sbjct: 256 PEPPREKSVPPPPPPPPP 273 >Z79596-2|CAC42251.1| 838|Caenorhabditis elegans Hypothetical protein C02C6.1b protein. Length = 838 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPP 452 P P PP P PP P PPP PP Sbjct: 767 PRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPP 798 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 529 PPPXPXTPXPPX-LXPXPXPPPXPXPPXPLXXXXPLT--PPXPPP 404 PPP P + P P P P P P PP P P PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPP 792 >U93842-1|AAB52421.1| 1409|Caenorhabditis elegans regulator of presynaptic activity protein. Length = 1409 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPP-XPLXXXXPLTPPXPP 407 PPP P PP P PPP PP P P PP PP Sbjct: 965 PPPVPPREAPP--IPKRNPPPLGAPPKVPEGARAP--PPLPP 1002 >U70845-1|AAB09098.1| 79|Caenorhabditis elegans Hypothetical protein F22H10.3 protein. Length = 79 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/46 (32%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -1 Query: 535 PFPPPXPXTPXP----PXLXPXPXPPPXPXPPXPLXXXXPLTPPXP 410 P+PPP P P P + P P P P P P+ P P Sbjct: 11 PYPPPVGYVPPPMGYAPPIAPIPMVAPMPVPVAPMMAAPMYGMPPP 56 >U58736-1|AAB00598.1| 302|Caenorhabditis elegans Dumpy : shorter than wild-typeprotein 3 protein. Length = 302 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P P PP P P P PP P P PP Sbjct: 125 PGAPGRPGNPGPPGRDGALLPGPPPKPPCQKCPPGPPGPAGPP 167 >U50310-5|AAA92541.1| 318|Caenorhabditis elegans Ground-like (grd related) protein 9 protein. Length = 318 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXP 446 PPP P P PPP P PP P Sbjct: 118 PPPVQYQNQGPQYIEAPPPPPSPPPPPP 145 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 517 PXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P PP P PP P P PP PPP P Sbjct: 114 PVQPPPPVQYQNQGPQYIEAPPPP-----PSPPPPPPPPPP 149 >U49945-3|AAM51509.1| 1408|Caenorhabditis elegans Aboc, expulsion defective protein3, isoform b protein. Length = 1408 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPP-XPLXXXXPLTPPXPP 407 PPP P PP P PPP PP P P PP PP Sbjct: 965 PPPVPPREAPP--IPKRNPPPLGAPPKVPEGARAP--PPLPP 1002 >U49945-2|AAC47926.1| 1409|Caenorhabditis elegans Aboc, expulsion defective protein3, isoform a protein. Length = 1409 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPP-XPLXXXXPLTPPXPP 407 PPP P PP P PPP PP P P PP PP Sbjct: 965 PPPVPPREAPP--IPKRNPPPLGAPPKVPEGARAP--PPLPP 1002 >U38378-1|AAA79751.1| 418|Caenorhabditis elegans Hypothetical protein R11F4.3 protein. Length = 418 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXP 410 PP P P P P PPP P P+ P P Sbjct: 166 PPIPDAPTNPPTTTTPPPPPPTRAPRPIIPTEVRRPQMP 204 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 523 PXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P TP P P P P P TPP PPP Sbjct: 147 PDLATPELPIPQPPRFAEVPPIPDAPTNPPTTTTPPPPPP 186 >AL021487-15|CAH60766.1| 618|Caenorhabditis elegans Hypothetical protein Y45F10B.13b protein. Length = 618 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 508 PXPPXLXPXPXPPPXPXPPXPL 443 P PP P PPP P PP P+ Sbjct: 241 PEPPREKSVPPPPPPPPPPKPV 262 Score = 24.6 bits (51), Expect(2) = 7.1 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 429 P*PPPXPPPXPL 394 P PPP PPP P+ Sbjct: 251 PPPPPPPPPKPV 262 Score = 22.2 bits (45), Expect(2) = 7.1 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -2 Query: 558 PXXPLXFXLSPPPXPXPP 505 P P + PPP P PP Sbjct: 241 PEPPREKSVPPPPPPPPP 258 >AL021487-14|CAA16360.3| 633|Caenorhabditis elegans Hypothetical protein Y45F10B.13a protein. Length = 633 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 508 PXPPXLXPXPXPPPXPXPPXPL 443 P PP P PPP P PP P+ Sbjct: 256 PEPPREKSVPPPPPPPPPPKPV 277 Score = 24.6 bits (51), Expect(2) = 7.1 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 429 P*PPPXPPPXPL 394 P PPP PPP P+ Sbjct: 266 PPPPPPPPPKPV 277 Score = 22.2 bits (45), Expect(2) = 7.1 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -2 Query: 558 PXXPLXFXLSPPPXPXPP 505 P P + PPP P PP Sbjct: 256 PEPPREKSVPPPPPPPPP 273 >AF167982-1|AAD50438.1| 838|Caenorhabditis elegans dynamin protein. Length = 838 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPP 452 P P PP P PP P PPP PP Sbjct: 767 PRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPP 798 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 529 PPPXPXTPXPPX-LXPXPXPPPXPXPPXPLXXXXPLT--PPXPPP 404 PPP P + P P P P P P PP P P PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPP 792 >AF000193-1|AAB52891.1| 715|Caenorhabditis elegans Hypothetical protein T20B6.2 protein. Length = 715 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -1 Query: 523 PXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTP--PXPPPXXP 395 P P P P P PPP P P P+ + P P PP P Sbjct: 547 PEPQNVEKPI--PKPNPPPAPAKPDPVPVVVAIDPVVPAPPEVVP 589 >U40802-2|AAM81104.1| 1010|Caenorhabditis elegans Dense body protein 1, isoform a protein. Length = 1010 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXP 461 P P P P L P P PPP P Sbjct: 786 PAPPRPPPPVELSPPPRPPPPP 807 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -2 Query: 558 PXXPLXFXLSPPPXPXPP 505 P P LSPPP P PP Sbjct: 789 PRPPPPVELSPPPRPPPP 806 Score = 23.0 bits (47), Expect(2) = 1.9 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 423 PPPXPPPXP 397 PPP PPP P Sbjct: 799 PPPRPPPPP 807 >J04804-1|AAA28002.1| 1010|Caenorhabditis elegans protein ( C.elegans vinculin (deb-1) gene, complete cds. ). Length = 1010 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXP 461 P P P P L P P PPP P Sbjct: 786 PAPPRPPPPVELSPPPRPPPPP 807 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -2 Query: 558 PXXPLXFXLSPPPXPXPP 505 P P LSPPP P PP Sbjct: 789 PRPPPPVELSPPPRPPPP 806 Score = 23.0 bits (47), Expect(2) = 1.9 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 423 PPPXPPPXP 397 PPP PPP P Sbjct: 799 PPPRPPPPP 807 >U40802-1|AAM81106.1| 999|Caenorhabditis elegans Dense body protein 1, isoform c protein. Length = 999 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXP 461 P P P P L P P PPP P Sbjct: 786 PAPPRPPPPVELSPPPRPPPPP 807 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -2 Query: 558 PXXPLXFXLSPPPXPXPP 505 P P LSPPP P PP Sbjct: 789 PRPPPPVELSPPPRPPPP 806 Score = 23.0 bits (47), Expect(2) = 1.9 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 423 PPPXPPPXP 397 PPP PPP P Sbjct: 799 PPPRPPPPP 807 >U40802-3|AAM81105.1| 369|Caenorhabditis elegans Dense body protein 1, isoform b protein. Length = 369 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXP 461 P P P P L P P PPP P Sbjct: 145 PAPPRPPPPVELSPPPRPPPPP 166 Score = 25.8 bits (54), Expect(2) = 2.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -2 Query: 558 PXXPLXFXLSPPPXPXPP 505 P P LSPPP P PP Sbjct: 148 PRPPPPVELSPPPRPPPP 165 Score = 23.0 bits (47), Expect(2) = 2.0 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 423 PPPXPPPXP 397 PPP PPP P Sbjct: 158 PPPRPPPPP 166 >Z95559-1|CAB08999.1| 289|Caenorhabditis elegans Hypothetical protein Y41E3.2 protein. Length = 289 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P PP P P P P P PP P PP PP Sbjct: 178 PIGPPGPPGQAGAPGEPG-SPAKSEPAVPGPPGPPGQAGQQGPPGPP 223 >Z82274-16|CAC70096.1| 1119|Caenorhabditis elegans Hypothetical protein JC8.10b protein. Length = 1119 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 535 PFPPPXPXT-PXPPXLXPX--PXPPPXPXPPXPLXXXXPLTPPXP 410 P P P P T P PP P PP P P P+ PP P Sbjct: 1072 PSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1116 >Z82274-15|CAB05234.2| 1113|Caenorhabditis elegans Hypothetical protein JC8.10a protein. Length = 1113 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 535 PFPPPXPXT-PXPPXLXPX--PXPPPXPXPPXPLXXXXPLTPPXP 410 P P P P T P PP P PP P P P+ PP P Sbjct: 1066 PSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1110 >Z82095-2|CAB05027.2| 602|Caenorhabditis elegans Hypothetical protein ZK849.4 protein. Length = 602 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPP 452 PPP P P P P P PP P PP Sbjct: 483 PPPSP--PALPPALPNPNEPPPPPPP 506 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 499 PXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P + PPP P P P P PP PPP Sbjct: 475 PVIVDGARPPPSP-PALPPALPNPNEPPPPPP 505 >Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical protein K02E2.2 protein. Length = 1021 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 511 TPXPPXLXPXPXPPPXPXPPXP 446 T PP P PPP P PP P Sbjct: 774 TTIPPPFFALPVPPPPPVPPPP 795 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXP 455 PPP P PP P P PPP P P Sbjct: 777 PPPFFALPVPP---PPPVPPPPPPP 798 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 508 PXPPXLXPXPXPPPXPXPPXP 446 P P P P PPP P PP P Sbjct: 777 PPPFFALPVPPPPPVPPPPPP 797 >Z69903-7|CAA93776.1| 1607|Caenorhabditis elegans Hypothetical protein F39B1.1 protein. Length = 1607 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP*XXXIXNXP 368 PP P P PP P P P PL PP PPP P + P Sbjct: 109 PPAFPPPPRPPKPEQYKFP---PAPSVPLLHDRYFVPP-PPPVPPRHSRVQQSP 158 >Z69660-1|CAA93489.1| 1607|Caenorhabditis elegans Hypothetical protein F39B1.1 protein. Length = 1607 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP*XXXIXNXP 368 PP P P PP P P P PL PP PPP P + P Sbjct: 109 PPAFPPPPRPPKPEQYKFP---PAPSVPLLHDRYFVPP-PPPVPPRHSRVQQSP 158 >U88314-13|ABR92611.1| 1346|Caenorhabditis elegans Formin homology domain protein 1 protein. Length = 1346 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = -1 Query: 535 PFPPPXPXTPXPPXL-XPXPXPPP---XPXPPXP 446 P PPP P PP L P PPP P PP P Sbjct: 771 PPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 Query: 517 PXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P PP P P PP P + PP PPP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPP---PLGIIPPPPPP 804 >AL132951-13|CAC70127.1| 1119|Caenorhabditis elegans Hypothetical protein JC8.10b protein. Length = 1119 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 535 PFPPPXPXT-PXPPXLXPX--PXPPPXPXPPXPLXXXXPLTPPXP 410 P P P P T P PP P PP P P P+ PP P Sbjct: 1072 PSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1116 >AL132951-12|CAC44311.1| 1113|Caenorhabditis elegans Hypothetical protein JC8.10a protein. Length = 1113 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 535 PFPPPXPXT-PXPPXLXPX--PXPPPXPXPPXPLXXXXPLTPPXP 410 P P P P T P PP P PP P P P+ PP P Sbjct: 1066 PSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1110 >AL132949-22|CAB70112.2| 603|Caenorhabditis elegans Hypothetical protein Y53F4B.25 protein. Length = 603 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXP 446 P P P P PP P PPP P P Sbjct: 446 PTPPPRLPQPPTAPPTVPPPPNQAPIVP 473 >AF283323-1|AAG18575.1| 1113|Caenorhabditis elegans synaptojanin UNC-26B protein. Length = 1113 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 535 PFPPPXPXT-PXPPXLXPX--PXPPPXPXPPXPLXXXXPLTPPXP 410 P P P P T P PP P PP P P P+ PP P Sbjct: 1066 PSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1110 >AF283322-1|AAG18574.1| 1119|Caenorhabditis elegans synaptojanin UNC-26A protein. Length = 1119 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 535 PFPPPXPXT-PXPPXLXPX--PXPPPXPXPPXPLXXXXPLTPPXP 410 P P P P T P PP P PP P P P+ PP P Sbjct: 1072 PSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1116 >AF098501-3|AAM69106.1| 275|Caenorhabditis elegans Hypothetical protein H28G03.2c protein. Length = 275 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP PP P PPP P+ P+ PP Sbjct: 121 PPPMSLLGPPPFSVPPSVPPPTSSAAAPIVPPPPVQSTAQPP 162 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPX-PPPXPXPPXPLXXXXP 428 P P PP + P P PPP PP PL P Sbjct: 75 PMPHHMGMPPPGMGPPPFMPPPIGMPPPPLGMPPP 109 >AF098501-2|AAM69105.1| 298|Caenorhabditis elegans Hypothetical protein H28G03.2b protein. Length = 298 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP PP P PPP P+ P+ PP Sbjct: 144 PPPMSLLGPPPFSVPPSVPPPTSSAAAPIVPPPPVQSTAQPP 185 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPX-PPPXPXPPXPLXXXXP 428 P P PP + P P PPP PP PL P Sbjct: 98 PMPHHMGMPPPGMGPPPFMPPPIGMPPPPLGMPPP 132 >AF098501-1|AAC67404.2| 548|Caenorhabditis elegans Hypothetical protein H28G03.2a protein. Length = 548 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PPP PP P PPP P+ P+ PP Sbjct: 394 PPPMSLLGPPPFSVPPSVPPPTSSAAAPIVPPPPVQSTAQPP 435 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPX-PPPXPXPPXPLXXXXP 428 P P PP + P P PPP PP PL P Sbjct: 348 PMPHHMGMPPPGMGPPPFMPPPIGMPPPPLGMPPP 382 >AC084158-11|AAK68558.1| 555|Caenorhabditis elegans Hypothetical protein Y69A2AR.14 protein. Length = 555 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 502 PPXLXPXPXPPPXPXPPXPLXXXXP 428 PP P P P P P PP P+ P Sbjct: 297 PPRRTPQPHPKPPPPPPPPIHEAQP 321 >AC006666-4|AAK21415.1| 109|Caenorhabditis elegans Hypothetical protein H31G24.1 protein. Length = 109 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P P P P PPP PP P P P P P Sbjct: 71 PPQPYAQSPIAAVPPPPPPP---PPQPAPAQAP-APKYPSP 107 >AB084086-1|BAC67013.1| 1346|Caenorhabditis elegans Formactin protein. Length = 1346 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = -1 Query: 535 PFPPPXPXTPXPPXL-XPXPXPPP---XPXPPXP 446 P PPP P PP L P PPP P PP P Sbjct: 771 PPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 Query: 517 PXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P PP P P PP P + PP PPP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPP---PLGIIPPPPPP 804 >Z66511-5|CAA91317.1| 1095|Caenorhabditis elegans Hypothetical protein F07A11.4 protein. Length = 1095 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 511 TPXPPXLXPXPXPPPXPXP 455 TP P L P P PPP P P Sbjct: 352 TPQPQSLVPPPPPPPPPPP 370 >Z46937-1|CAA87056.2| 1036|Caenorhabditis elegans Hypothetical protein F43C1.1 protein. Length = 1036 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXP 446 P P PP P P P P PPP P P Sbjct: 939 PEYHPSPPVPPPIPAIRHRTPSPPPPPLPSSTPP 972 >U97196-12|AAB52456.2| 564|Caenorhabditis elegans Hypothetical protein B0207.1 protein. Length = 564 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = -1 Query: 508 PXPPXLXPXPXPP----PXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P PP P P P+ P PP P P P Sbjct: 91 PTPVKTPPLPRPPGNLNPVQQPQIPVQRTPPQCPPPPVPHPP 132 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -1 Query: 487 PXPXPPPXPXPPXPLXXXXPLTP--PXPPPXXP 395 P PPP P PP + P+ P P PPP P Sbjct: 121 PQCPPPPVPHPPQ-ITQMAPILPTSPAPPPPIP 152 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXP 446 +P P PPP P P + P P P PP P Sbjct: 119 TPPQCP-PPPVPHPPQITQMAPILPTSPAPPPPIP 152 >U40421-1|AAA81437.2| 178|Caenorhabditis elegans Helix loop helix protein 8 protein. Length = 178 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXP 410 PPP P + P L P P P P P++ P P Sbjct: 126 PPPAPSSIPPHCLMPQPWYQTCPPPKQEFHELCPISTPNP 165 >AF037063-1|AAC26105.1| 178|Caenorhabditis elegans twist protein. Length = 178 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXP 410 PPP P + P L P P P P P++ P P Sbjct: 126 PPPAPSSIPPHCLMPQPWYQTCPPPKQEFHELCPISTPNP 165 >AF003151-19|AAK18922.1| 988|Caenorhabditis elegans Hypothetical protein D1007.7 protein. Length = 988 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXP 410 PP P P P P P P P P P PP P Sbjct: 707 PPPPGIPGYPPAPPPPGVGPPPPQGIPPMGFDPNKPPPP 745 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPP-XLXPXPXPPPXPXPPXPLXXXXPLTPPXP 410 P P PPP P PP + P P P PP PP P Sbjct: 713 PGYPPAPPPPGVGPPPPQGIPPMGFDPNKPPPPMFQQGFNAGAPPPP 759 >AC024859-11|AAK29981.1| 933|Caenorhabditis elegans Hypothetical protein Y71H2AM.15a protein. Length = 933 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = -1 Query: 508 PXPPXLXPXPXPPPX----PXPPXPLXXXXPLTPPXPPPXXP 395 P P L P P PP PL P PP PPP P Sbjct: 761 PGSPRLPPKPSVAQTIAMHSAPPSPLTAPIPPPPPPPPPMLP 802 >AC024859-10|ABA00158.1| 832|Caenorhabditis elegans Hypothetical protein Y71H2AM.15b protein. Length = 832 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = -1 Query: 508 PXPPXLXPXPXPPPX----PXPPXPLXXXXPLTPPXPPPXXP 395 P P L P P PP PL P PP PPP P Sbjct: 660 PGSPRLPPKPSVAQTIAMHSAPPSPLTAPIPPPPPPPPPMLP 701 >AC006696-4|AAF39985.1| 215|Caenorhabditis elegans Hypothetical protein W08E12.6 protein. Length = 215 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 PPP P P + P PPP P P P P P Sbjct: 41 PPPCFDCPPPAPIFVAPPPPPCFGPACPPPCFGPACVPLAP 81 >Z79756-9|CAK12562.1| 830|Caenorhabditis elegans Hypothetical protein F53C11.5c protein. Length = 830 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXP--PXPLXXXXPLTPPXPPP 404 PPP + PP P P P P P + LT PPP Sbjct: 416 PPPSQSSNIPPPSLPSPRPSALPAPGFSRQISSATTLTAQAPPP 459 >Z79756-8|CAB02122.1| 891|Caenorhabditis elegans Hypothetical protein F53C11.5b protein. Length = 891 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXP--PXPLXXXXPLTPPXPPP 404 PPP + PP P P P P P + LT PPP Sbjct: 477 PPPSQSSNIPPPSLPSPRPSALPAPGFSRQISSATTLTAQAPPP 520 >Z79756-7|CAK12561.1| 855|Caenorhabditis elegans Hypothetical protein F53C11.5a protein. Length = 855 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXP--PXPLXXXXPLTPPXPPP 404 PPP + PP P P P P P + LT PPP Sbjct: 441 PPPSQSSNIPPPSLPSPRPSALPAPGFSRQISSATTLTAQAPPP 484 >Z74042-8|CAA98525.1| 299|Caenorhabditis elegans Hypothetical protein T11F9.9 protein. Length = 299 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 4/55 (7%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPX-PPPXPXPPX--PLXXXXPLTPPXPP-PXXP 395 P P P P P P L P PP P P P P PP PP P P Sbjct: 107 PAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCDPITPPPCQPCPQGPPGPPGPPGP 161 >Z74036-2|CAA98487.1| 266|Caenorhabditis elegans Hypothetical protein F55C10.3 protein. Length = 266 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 4/55 (7%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPX-PPPXPXPPX--PLXXXXPLTPPXPP-PXXP 395 P P P P P P L P PP P P P P PP PP P P Sbjct: 74 PAGTPGKPGRPGKPGAPGLPGNPGHPPQQPCDPITPPPCQPCPQGPPGPPGPPGP 128 >Z74036-1|CAA98486.1| 299|Caenorhabditis elegans Hypothetical protein F55C10.2 protein. Length = 299 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 4/55 (7%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPX-PPPXPXPPX--PLXXXXPLTPPXPP-PXXP 395 P P P P P P L P PP P P P P PP PP P P Sbjct: 107 PAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCDPITPPPCQPCPQGPPGPPGPPGP 161 >Z74031-17|CAN86923.1| 380|Caenorhabditis elegans Hypothetical protein F32D8.7b protein. Length = 380 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = -1 Query: 535 PFPPPXPXTPXPPX--LXPXPXPPPXPXPPXP 446 P P P P P L P PPP P PP P Sbjct: 225 PAPTLAPFRPRPTTRRLPPPTTPPPPPPPPAP 256 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPP 452 +P PF P PP P P PPP P Sbjct: 226 APTLAPFRPRPTTRRLPPPTTPPPPPPPPAPSP 258 >Z74031-16|CAA98452.1| 378|Caenorhabditis elegans Hypothetical protein F32D8.7a protein. Length = 378 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = -1 Query: 535 PFPPPXPXTPXPPX--LXPXPXPPPXPXPPXP 446 P P P P P L P PPP P PP P Sbjct: 223 PAPTLAPFRPRPTTRRLPPPTTPPPPPPPPAP 254 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPP 452 +P PF P PP P P PPP P Sbjct: 224 APTLAPFRPRPTTRRLPPPTTPPPPPPPPAPSP 256 >Z68760-2|CAA92995.1| 597|Caenorhabditis elegans Hypothetical protein F36H1.3 protein. Length = 597 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P P P L P P P P P P P P Sbjct: 502 PPAPPAIPSPAKLPTAPPPVEKPVTPSPSASPLPSPVSSPAP 543 >Z68219-2|CAA92476.1| 300|Caenorhabditis elegans Hypothetical protein T05A1.2 protein. Length = 300 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = -1 Query: 550 SPXXXPFPPPXPX-TPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 SP PPP P P PP P P PP P P P P Sbjct: 136 SPCEPLTPPPCPACPPGPPGAPGAPGKPGSEGPPGPPGHDGPNGGPGQP 184 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP 416 P P P P TP P P P PP P P P PP Sbjct: 130 PGKPPQSPCEPLTPPPCPACP-PGPPGAPGAPGKPGSEGPPGPP 172 >Z66563-2|CAA91469.3| 2557|Caenorhabditis elegans Hypothetical protein F46C3.3 protein. Length = 2557 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = -1 Query: 517 PXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P TP P + P P P P PP PPP Sbjct: 1695 PITPAQPPITQSPVPSEPVVVRTPSPVPQPTPPPPPPP 1732 >Z37983-4|CAA86057.1| 803|Caenorhabditis elegans Hypothetical protein B0393.4 protein. Length = 803 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = -1 Query: 526 PPXPXTPXPPXLX---PXPXPPPXPXP-PXPLXXXXPLTPPXP 410 PP TP P + P P P P P P P P P++ P P Sbjct: 97 PPRNSTPQVPKVAVTLPVPEPVPEPVPEPVPESTPEPISEPLP 139 >U88172-5|AAB42260.1| 483|Caenorhabditis elegans Hypothetical protein ZK354.8 protein. Length = 483 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPP---PXPXPPXPLXXXXPLTPPXPPPXXP 395 PPP P PP + P PP PP P L P P P Sbjct: 92 PPPSDPPPPPPPVAPHQPPPQLATSAQPPQPPVINSQLPRMSPAPAIP 139 >U53155-5|AAC48270.1| 303|Caenorhabditis elegans Collagen protein 43 protein. Length = 303 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P P P P P P P P P PP P Sbjct: 124 PGAPGQPGVPGKPPTAPCEPTTPPPCKPCPQGPPGPPGPPGAP 166 >U00058-3|AAD31933.1| 162|Caenorhabditis elegans Ground-like (grd related) protein22 protein. Length = 162 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 481 PXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P PP P+ P PP PPP Sbjct: 34 PAAPACAPPPPPMCGCAPPPPPPPPP 59 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -1 Query: 523 PXPXTPXPPXLXPXPXPPPXPXPP 452 P P PP P PPP P PP Sbjct: 37 PACAPPPPPMCGCAPPPPPPPPPP 60 Score = 23.8 bits (49), Expect(2) = 8.1 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 423 PPPXPPPXPL 394 PPP PPP P+ Sbjct: 52 PPPPPPPPPM 61 Score = 23.0 bits (47), Expect(2) = 8.1 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -2 Query: 558 PXXPLXFXLSPPPXPXPP 505 P P+ PPP P PP Sbjct: 42 PPPPMCGCAPPPPPPPPP 59 >AL132864-1|CAB63392.1| 613|Caenorhabditis elegans Hypothetical protein Y53H1A.1 protein. Length = 613 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP 416 P P PP P P PP P P P PP P P PP Sbjct: 133 PQHFPPGPPRPHFPGPP--GPHRPPEHYPGPPRP---QAPAAPP 171 >AF025467-2|AAN65301.1| 505|Caenorhabditis elegans Hypothetical protein R148.5b protein. Length = 505 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP--XPPP 404 P P P P PP P PP PP P PP PPP Sbjct: 275 PYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFMPPP 324 Score = 28.7 bits (61), Expect = 6.4 Identities = 20/63 (31%), Positives = 22/63 (34%), Gaps = 9/63 (14%) Frame = -1 Query: 556 FXSPXXXPFPPPXP----XTPXPPXLXPXP-----XPPPXPXPPXPLXXXXPLTPPXPPP 404 F P FPPP P PP + P P P PP P+ PP PP Sbjct: 296 FPPPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGMGPPRGFMPPPHPMMFRGGPYPPFFPP 355 Query: 403 XXP 395 P Sbjct: 356 PPP 358 >AF025467-1|AAB71039.2| 528|Caenorhabditis elegans Hypothetical protein R148.5a protein. Length = 528 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP--XPPP 404 P P P P PP P PP PP P PP PPP Sbjct: 275 PYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFMPPP 324 Score = 28.7 bits (61), Expect = 6.4 Identities = 20/63 (31%), Positives = 22/63 (34%), Gaps = 9/63 (14%) Frame = -1 Query: 556 FXSPXXXPFPPPXP----XTPXPPXLXPXP-----XPPPXPXPPXPLXXXXPLTPPXPPP 404 F P FPPP P PP + P P P PP P+ PP PP Sbjct: 296 FPPPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGMGPPRGFMPPPHPMMFRGGPYPPFFPP 355 Query: 403 XXP 395 P Sbjct: 356 PPP 358 >AC024772-3|AAF60538.1| 2344|Caenorhabditis elegans Hypothetical protein Y40C5A.3 protein. Length = 2344 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = -1 Query: 526 PPXPXTPXP-PXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P P P P P P P P P P LT P P P Sbjct: 2029 PQFRPQPQPRPQPQPQPQPQPQPQPQQPYIQRPALTLPFQQPQYP 2073 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXP 410 P + P P P L P P P P PL PL P P Sbjct: 1730 PVEHRYEIPAPGPAPGPALEPAPAPTSAPQIVEPLPPVQPLPQPQP 1775 >AC006638-2|AAK85481.1| 1256|Caenorhabditis elegans Cyclase associated protein homologprotein 1, isoform a protein. Length = 1256 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = -1 Query: 523 PXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP 416 P P P P PP P PP P + PP Sbjct: 995 PSAAAPSAPKAPAGPGGPPPPPPPPPADFFANIAPP 1030 >AC006638-1|AAK85482.1| 495|Caenorhabditis elegans Cyclase associated protein homologprotein 1, isoform b protein. Length = 495 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = -1 Query: 523 PXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP 416 P P P P PP P PP P + PP Sbjct: 234 PSAAAPSAPKAPAGPGGPPPPPPPPPADFFANIAPP 269 >AB072926-1|BAB69889.1| 303|Caenorhabditis elegans collagen protein. Length = 303 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P P P P P P P P P PP P Sbjct: 124 PGAPGQPGVPGKPPTAPCEPTTPPPCKPCPQGPPGPPGPPGAP 166 >U61954-7|AAK29803.1| 1140|Caenorhabditis elegans Hypothetical protein F41H10.3a protein. Length = 1140 Score = 24.2 bits (50), Expect(2) = 4.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPP 470 PP P P PP P P PP Sbjct: 683 PPQPQQPPPP--LPTPKPP 699 Score = 23.4 bits (48), Expect(2) = 4.0 Identities = 9/26 (34%), Positives = 11/26 (42%) Frame = -1 Query: 481 PXPPPXPXPPXPLXXXXPLTPPXPPP 404 P PP P P+ P+ P P P Sbjct: 723 PAPPVPAAPVAPVVPIVPIVPVHPVP 748 >U61954-8|AAM98018.1| 1005|Caenorhabditis elegans Hypothetical protein F41H10.3b protein. Length = 1005 Score = 24.2 bits (50), Expect(2) = 4.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPP 470 PP P P PP P P PP Sbjct: 683 PPQPQQPPPP--LPTPKPP 699 Score = 23.4 bits (48), Expect(2) = 4.1 Identities = 9/26 (34%), Positives = 11/26 (42%) Frame = -1 Query: 481 PXPPPXPXPPXPLXXXXPLTPPXPPP 404 P PP P P+ P+ P P P Sbjct: 723 PAPPVPAAPVAPVVPIVPIVPVHPVP 748 >Z83316-8|CAB54186.1| 409|Caenorhabditis elegans Hypothetical protein B0379.7 protein. Length = 409 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/52 (26%), Positives = 17/52 (32%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 +P P P P P P P P P+ P+T P P P Sbjct: 76 APAPVQCPEPTPEVPQQPTQVSAPVQEITQGAPAPIPEPTPVTAEQPTPVDP 127 >Z83114-7|CAJ76943.1| 525|Caenorhabditis elegans Hypothetical protein K09B11.5b protein. Length = 525 Score = 29.1 bits (62), Expect = 4.8 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = -1 Query: 535 PFPPPX--PXTPXPPXLXPXPXPPPXPXPP--XPLXXXXPLTPPXPPPXXP 395 P PP P PP P PP PP P P+TPP P Sbjct: 472 PMTPPVSQPPVSQPPVSQPPVSQPPVSQPPVSQPPVPQHPMTPPPASSARP 522 >Z83114-6|CAB63235.1| 589|Caenorhabditis elegans Hypothetical protein K09B11.5a protein. Length = 589 Score = 29.1 bits (62), Expect = 4.8 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = -1 Query: 535 PFPPPX--PXTPXPPXLXPXPXPPPXPXPP--XPLXXXXPLTPPXPPPXXP 395 P PP P PP P PP PP P P+TPP P Sbjct: 536 PMTPPVSQPPVSQPPVSQPPVSQPPVSQPPVSQPPVPQHPMTPPPASSARP 586 >Z81055-7|CAB02897.2| 445|Caenorhabditis elegans Hypothetical protein F01G10.9 protein. Length = 445 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/52 (30%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -1 Query: 547 PXXXPFPPPXPXT-PXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 P P+ P P T P P P P P P+ P P P P P Sbjct: 299 PYNQPYRVPGPMTLPVSSTTNMLHRPVPLPGAPQPMRIPLPPGAPMPMPLAP 350 >U58757-9|AAM75377.1| 503|Caenorhabditis elegans Hypothetical protein C01B10.6b protein. Length = 503 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPP 452 PP P P P P PP P PP Sbjct: 395 PPDQSCPKPSPTDPTPVPPVAPTPP 419 >U58757-8|AAC47918.3| 506|Caenorhabditis elegans Hypothetical protein C01B10.6a protein. Length = 506 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPP 452 PP P P P P PP P PP Sbjct: 398 PPDQSCPKPSPTDPTPVPPVAPTPP 422 >U53333-6|AAA96159.2| 304|Caenorhabditis elegans Collagen protein 33 protein. Length = 304 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P P P + P P P P P P PP PP Sbjct: 125 PGAPGLPGNPGKPPVQPCEPITPPPCKPCP---DGPAGPPGPP 164 >AL132898-14|CAC14406.1| 1641|Caenorhabditis elegans Hypothetical protein Y59A8B.1a protein. Length = 1641 Score = 29.1 bits (62), Expect = 4.8 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXP---XPPPXPXPPXPLXXXXPLTPPXPPP 404 SP P PPP P T P + P PP P P+T PPP Sbjct: 869 SPSPSPSPPPPPETTLTPIVLPRKKQRIEKKKLTPPPP--QQAPVTSHTPPP 918 >AL117204-20|CAB55136.2| 699|Caenorhabditis elegans Hypothetical protein Y116A8C.32 protein. Length = 699 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 523 PXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P P PPP P P L PP PP Sbjct: 660 PMPVPPPGGLGGFMPPPPPPPPMPGDLSSLLAAAPPPPP 698 >AJ243905-1|CAB64866.1| 699|Caenorhabditis elegans SF1 protein protein. Length = 699 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 523 PXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P P PPP P P L PP PP Sbjct: 660 PMPVPPPGGLGGFMPPPPPPPPMPGDLSSLLAAAPPPPP 698 >AF098999-4|AAC68729.1| 659|Caenorhabditis elegans Hypothetical protein W04C9.6 protein. Length = 659 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPP 452 PP P P + P PPP P PP Sbjct: 479 PPSPPSYVMAPMIRMAPAPPPPPMPP 504 >Z98866-26|CAM33505.1| 559|Caenorhabditis elegans Hypothetical protein Y49E10.29 protein. Length = 559 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/41 (29%), Positives = 14/41 (34%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P P P PP P+ P+ PPP Sbjct: 224 PPVQQASPKPVAQPVQQQPVVQAPPKPIVQQAPVVQQAPPP 264 >Z81135-1|CAB03453.1| 627|Caenorhabditis elegans Hypothetical protein W01G7.1 protein. Length = 627 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPL 443 PP P P PP P P P P P P L Sbjct: 512 PPLPPLPPPP---PPPKPKPAPVQPISL 536 >Z70266-6|CAD57691.1| 795|Caenorhabditis elegans Hypothetical protein C40C9.5b protein. Length = 795 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXP 461 F S PFPPP PP L P P P Sbjct: 632 FSSYANLPFPPPPMPPSPPPELTTKPKPSESP 663 >Z70266-5|CAA94208.1| 798|Caenorhabditis elegans Hypothetical protein C40C9.5a protein. Length = 798 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXP 461 F S PFPPP PP L P P P Sbjct: 632 FSSYANLPFPPPPMPPSPPPELTTKPKPSESP 663 >Z70208-2|CAA94136.1| 304|Caenorhabditis elegans Hypothetical protein F54B11.2 protein. Length = 304 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 523 PXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P P P P P PP P P PP PP Sbjct: 219 PEPAAPGPAG-PPGPAGPPGPDGASPTAAPGAAGPPGPP 256 >Z70205-10|CAA94122.2| 887|Caenorhabditis elegans Hypothetical protein E02H4.3a protein. Length = 887 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXP--PXLXPXPXPPPXPXPPXPLXXXXPLTPP 416 +P P P P P P P + P P PP P+ PL PP Sbjct: 230 APEANPAPVPTATKPSPFAPAIAPLRDGAPAQ-PPAPIQASAPLRPP 275 >Z69664-10|CAC42313.1| 1311|Caenorhabditis elegans Hypothetical protein T14G10.2b protein. Length = 1311 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P P P L P P PP L PL P P Sbjct: 174 PPPPVPPRPLRLPQTAAKGPAPLPPRGLPRTYPLDFPVDIP 214 >Z69664-9|CAA93519.2| 1470|Caenorhabditis elegans Hypothetical protein T14G10.2a protein. Length = 1470 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P P P L P P PP L PL P P Sbjct: 174 PPPPVPPRPLRLPQTAAKGPAPLPPRGLPRTYPLDFPVDIP 214 >Z68880-11|CAC42342.1| 1311|Caenorhabditis elegans Hypothetical protein T14G10.2b protein. Length = 1311 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P P P L P P PP L PL P P Sbjct: 174 PPPPVPPRPLRLPQTAAKGPAPLPPRGLPRTYPLDFPVDIP 214 >Z68880-10|CAA93100.2| 1470|Caenorhabditis elegans Hypothetical protein T14G10.2a protein. Length = 1470 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P P P L P P PP L PL P P Sbjct: 174 PPPPVPPRPLRLPQTAAKGPAPLPPRGLPRTYPLDFPVDIP 214 >Z68003-5|CAA91979.2| 887|Caenorhabditis elegans Hypothetical protein E02H4.3a protein. Length = 887 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXP--PXLXPXPXPPPXPXPPXPLXXXXPLTPP 416 +P P P P P P P + P P PP P+ PL PP Sbjct: 230 APEANPAPVPTATKPSPFAPAIAPLRDGAPAQ-PPAPIQASAPLRPP 275 >U56966-4|AAA98719.2| 906|Caenorhabditis elegans Ace(angiotensin converting enzyme)-like non-peptidase protein 1, isoform a protein. Length = 906 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP 455 P P P P P P P P P P P P Sbjct: 63 PVPEPEPKPEPEPEPEPKPEPEPSPTPEPEP 93 >U56966-3|AAU05584.1| 332|Caenorhabditis elegans Ace(angiotensin converting enzyme)-like non-peptidase protein 1, isoform b protein. Length = 332 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXP 455 P P P P P P P P P P P P Sbjct: 63 PVPEPEPKPEPEPEPEPKPEPEPSPTPEPEP 93 >U41557-6|AAA83307.1| 589|Caenorhabditis elegans Collagen sequence x-hybridizingprotein 1 protein. Length = 589 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 P P P P P P P P PP P P P P P Sbjct: 60 PPPAPRPSGQPPGPQGPSDLPGPSGAPPGPPHPSGPPHRPHPHP 103 >AY438643-1|AAR00670.1| 627|Caenorhabditis elegans abnormal DAuer Formation DAF-5,a Ski oncogene homolog involved in a neuronal TGF betapathway (71.0 kD) (daf-5) protein. Length = 627 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPL 443 PP P P PP P P P P P P L Sbjct: 512 PPLPPLPPPP---PPPKPKPAPVQPISL 536 >AL023827-4|CAD57709.1| 795|Caenorhabditis elegans Hypothetical protein C40C9.5b protein. Length = 795 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXP 461 F S PFPPP PP L P P P Sbjct: 632 FSSYANLPFPPPPMPPSPPPELTTKPKPSESP 663 >AL023827-3|CAA19446.1| 798|Caenorhabditis elegans Hypothetical protein C40C9.5a protein. Length = 798 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 556 FXSPXXXPFPPPXPXTPXPPXLXPXPXPPPXP 461 F S PFPPP PP L P P P Sbjct: 632 FSSYANLPFPPPPMPPSPPPELTTKPKPSESP 663 >AF308449-1|AAL09435.1| 1347|Caenorhabditis elegans PXF isoform C protein. Length = 1347 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P P P L P P PP L PL P P Sbjct: 51 PPPPVPPRPLRLPQTAAKGPAPLPPRGLPRTYPLDFPVDIP 91 >AF308448-1|AAL09434.1| 1311|Caenorhabditis elegans PXF isoform B protein. Length = 1311 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P P P L P P PP L PL P P Sbjct: 174 PPPPVPPRPLRLPQTAAKGPAPLPPRGLPRTYPLDFPVDIP 214 >AF308447-1|AAL09433.1| 1470|Caenorhabditis elegans PXF isoform A protein. Length = 1470 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P P P L P P PP L PL P P Sbjct: 174 PPPPVPPRPLRLPQTAAKGPAPLPPRGLPRTYPLDFPVDIP 214 >AF170796-1|AAF22963.1| 1470|Caenorhabditis elegans RA-GEF protein. Length = 1470 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 526 PPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPP 404 PP P P P L P P PP L PL P P Sbjct: 174 PPPPVPPRPLRLPQTAAKGPAPLPPRGLPRTYPLDFPVDIP 214 >AC024200-14|AAF36005.1| 557|Caenorhabditis elegans Hypothetical protein Y71F9AL.4 protein. Length = 557 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -1 Query: 499 PXLXPXPXPPPXPXPPXPLXXXXPLTPP 416 P L P P P P P P P+TPP Sbjct: 502 PSLSRNPSPDPVPSPLTPPVPPSPMTPP 529 >Z99773-3|CAE11316.1| 305|Caenorhabditis elegans Hypothetical protein H06A10.2 protein. Length = 305 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = -1 Query: 550 SPXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPPPXXP 395 +P PPP P P P P P P P P P P P P Sbjct: 142 APCEAKTPPPCQPCPAGPPGPPGPDGPAGPAGPDG-EAGSPAAPSPPGPPGP 192 >Z84574-5|CAB06541.1| 846|Caenorhabditis elegans Hypothetical protein F33E2.6 protein. Length = 846 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXPXPP---XPLXXXXPLTPPXPPP 404 P P T PP + P PP PP P TPP P Sbjct: 378 PKTEPPTTEPPKIEPPRTEPPKTEPPPTEPPKTEPPKTTPPKTEP 422 >Z81129-3|CAB03404.1| 1262|Caenorhabditis elegans Hypothetical protein T23F1.5 protein. Length = 1262 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPPPXPXPPXPLXXXXPLTPP 416 P P+ PP P P P P P P P P TPP Sbjct: 542 PLINPYIPPPPP-PHPEEEYATPYTVPPGKQPFPPFGEGPATPP 584 >Z81034-4|CAB02729.1| 541|Caenorhabditis elegans Hypothetical protein C15C6.3 protein. Length = 541 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 529 PPPXPXTPXPPXLXPXPXPPPXP 461 PPP P P PP P PPP P Sbjct: 476 PPPPP--PPPPENEPEEFPPPPP 496 >Z79604-3|CAD36502.1| 817|Caenorhabditis elegans Hypothetical protein ZK662.3b protein. Length = 817 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = -1 Query: 508 PXPPXLXPXPXPPPXPXP---PXPLXXXXPLTPPXPPPXXP 395 P P L P PP P P P L+ P PPP P Sbjct: 401 PLDPLLAPAFIAPPMPTPINVPITTPIAGALSTPLPPPIVP 441 >Z79604-2|CAB01900.1| 780|Caenorhabditis elegans Hypothetical protein ZK662.3a protein. Length = 780 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = -1 Query: 508 PXPPXLXPXPXPPPXPXP---PXPLXXXXPLTPPXPPPXXP 395 P P L P PP P P P L+ P PPP P Sbjct: 364 PLDPLLAPAFIAPPMPTPINVPITTPIAGALSTPLPPPIVP 404 >Z35640-1|CAA84705.1| 307|Caenorhabditis elegans Hypothetical protein F43D9.2 protein. Length = 307 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 523 PXPXTPXPPXLXPXPXPPPXPXPPXP 446 P P P P P P PP P PP P Sbjct: 51 PSPAVPSTPVRVPYPTAPP-PIPPAP 75 >U80447-9|AAB37813.1| 230|Caenorhabditis elegans Hypothetical protein F55F8.8 protein. Length = 230 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -1 Query: 475 PPPXPXPPXPLXXXXPLTPPXPPP 404 P P P PP PL + P PPP Sbjct: 79 PIPAPIPPPPLPGQQVIIRPAPPP 102 >AF332205-1|AAK17976.1| 817|Caenorhabditis elegans nuclear receptor NHR-48 protein. Length = 817 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = -1 Query: 508 PXPPXLXPXPXPPPXPXP---PXPLXXXXPLTPPXPPPXXP 395 P P L P PP P P P L+ P PPP P Sbjct: 401 PLDPLLAPAFIAPPMPTPINVPITTPIAGALSTPLPPPIVP 441 >AF332204-1|AAK17975.1| 519|Caenorhabditis elegans nuclear receptor NHR-48 protein. Length = 519 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = -1 Query: 508 PXPPXLXPXPXPPPXPXP---PXPLXXXXPLTPPXPPPXXP 395 P P L P PP P P P L+ P PPP P Sbjct: 103 PLDPLLAPAFIAPPMPTPINVPITTPIAGALSTPLPPPIVP 143 >AF125964-1|AAD14753.1| 471|Caenorhabditis elegans Hypothetical protein W03G1.5 protein. Length = 471 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -1 Query: 535 PFPPPXPXTPXPPXLXPXPXPPPXPXP 455 PFPP PP P P PPP P Sbjct: 425 PFPPHHGHHHFPPFWPPCPPPPPFWPP 451 >AF067209-1|AAC16982.2| 553|Caenorhabditis elegans Warthog (hedgehog-like family)protein 9 protein. Length = 553 Score = 28.3 bits (60), Expect = 8.4 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 5/52 (9%) Frame = -1 Query: 547 PXXXPFPPPXPXT-----PXPPXLXPXPXPPPXPXPPXPLXXXXPLTPPXPP 407 P P PPP P P P P P P PP P P P P Sbjct: 343 PVTQPTPPPNPFVFAPLPPFPQFGLPQPNLFQFPAPPAPPPFGVPQAPQLAP 394 >AC084153-9|AAK84592.1| 90|Caenorhabditis elegans Hypothetical protein Y22D7AL.3 protein. Length = 90 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 547 PXXXPFPPPXPXTPXPPXLXPXPXPP 470 P FPPP P P P + P PP Sbjct: 8 PNFPNFPPPPPPKPKPIVVNDQPRPP 33 >Z19158-2|CAA79571.3| 262|Caenorhabditis elegans Hypothetical protein T23G5.3 protein. Length = 262 Score = 23.4 bits (48), Expect(2) = 9.9 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 Query: 558 PXXPLXFXLSPPPXPXPP 505 P P LS PP P PP Sbjct: 130 PIVPRNLLLSKPPPPPPP 147 Score = 23.0 bits (47), Expect(2) = 9.9 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 423 PPPXPPPXP 397 PPP PPP P Sbjct: 142 PPPPPPPLP 150 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,066,120 Number of Sequences: 27780 Number of extensions: 164708 Number of successful extensions: 6259 Number of sequences better than 10.0: 198 Number of HSP's better than 10.0 without gapping: 988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3668 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2433684176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -