BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C23 (879 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) 167 1e-41 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 133 2e-31 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 122 4e-28 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 122 4e-28 SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 70 2e-12 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) 61 1e-09 SB_51245| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_54507| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58426| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57366| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56245| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55566| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55077| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53790| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52894| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48533| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47211| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_46066| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45109| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_43715| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42865| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41269| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40020| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_38531| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_35148| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_31008| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_29391| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_24808| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_23019| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_21707| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_19542| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_19098| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_19031| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_17805| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_15695| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_12040| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_9760| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_5267| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) 58 7e-09 SB_1707| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_1382| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_1275| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 9e-08 SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 9e-08 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_10421| Best HMM Match : Guanylate_cyc (HMM E-Value=0) 53 4e-07 SB_52929| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 52 6e-07 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 8e-07 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) 48 1e-05 SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) 47 2e-05 SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_6381| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 47 2e-05 SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25376| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32393| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_2276| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59347| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 41 0.002 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24699| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_15282| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 41 0.002 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 40 0.002 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_41802| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34775| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_32513| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_29655| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_24687| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6708| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 40 0.003 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_26089| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_45032| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 39 0.005 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_29950| Best HMM Match : A2M_comp (HMM E-Value=7.1) 38 0.008 SB_2327| Best HMM Match : HTH_1 (HMM E-Value=6.1e-11) 38 0.014 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 37 0.019 SB_55951| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_55453| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_51471| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_46397| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_27300| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_21455| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_20356| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_16282| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_6959| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_6102| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 37 0.025 SB_5610| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_2852| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_2781| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_45889| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_43474| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_42098| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_39127| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_25846| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_23237| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_21710| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.057 SB_2596| Best HMM Match : Extensin_2 (HMM E-Value=0.083) 31 0.93 SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 >SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 167 bits (406), Expect = 1e-41 Identities = 74/78 (94%), Positives = 75/78 (96%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGYTRR 531 PP QPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGYTRR Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGYTRR 71 Query: 532 XVFGICALLKPVTFGKRV 585 VFGICALLKPVTFGK + Sbjct: 72 TVFGICALLKPVTFGKEL 89 Score = 33.1 bits (72), Expect = 0.30 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 578 KELVALDPANKPPLVA 625 KELVALDPANK PLVA Sbjct: 87 KELVALDPANKTPLVA 102 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 133 bits (322), Expect = 2e-31 Identities = 58/59 (98%), Positives = 58/59 (98%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGYTR 528 PP QPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGYTR Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLKWWPNYGYTR 70 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 122 bits (294), Expect = 4e-28 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 45 SKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCA 209 SKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCA Sbjct: 100 SKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCA 154 Score = 118 bits (283), Expect = 8e-27 Identities = 50/60 (83%), Positives = 51/60 (85%) Frame = +1 Query: 187 PWKLPRALSXFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPPXQP 366 P + P FRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPP P Sbjct: 147 PLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPPFSP 206 Score = 44.8 bits (101), Expect = 9e-05 Identities = 30/61 (49%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +2 Query: 236 RIPVRLSPFGKRGAFS*LTL*VSQFGVG-RSLQAGLCART-PRFSPTAAPYPVTIVLSPT 409 R+P PF R A+ L V RS T P FSPTAAPYPVTIVLSPT Sbjct: 161 RLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPPFSPTAAPYPVTIVLSPT 220 Query: 410 R 412 R Sbjct: 221 R 221 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 122 bits (294), Expect = 4e-28 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 45 SKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCA 209 SKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCA Sbjct: 129 SKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCA 183 Score = 73.3 bits (172), Expect = 2e-13 Identities = 33/56 (58%), Positives = 37/56 (66%) Frame = +1 Query: 187 PWKLPRALSXFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNP 354 P + P FRPCRLPDTCPPFSLREAWRFLIAHAV I ++F S + P Sbjct: 176 PLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVAIRTAKKTFQGSTSSMAAP 231 >SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 83.0 bits (196), Expect = 3e-16 Identities = 42/57 (73%), Positives = 46/57 (80%) Frame = -2 Query: 239 SGKRQGRXQESARGSFQGETPGIFIVLSGFATSDLSVDFCDARQGGGAYGKTPATRP 69 +GK + + QESARGS QGET GIFIVLSGFAT+DLSV F DA QGGGAYGKT RP Sbjct: 3 TGKPKRQEQESARGSRQGETLGIFIVLSGFATTDLSVRFRDACQGGGAYGKTALPRP 59 >SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 72.1 bits (169), Expect = 5e-13 Identities = 35/54 (64%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = +1 Query: 301 ISVRCRSFAPSWAVCTN-PPXQPDRCALSGNYRLESNPVRHDLSPLAAATGNRI 459 + V+C+ S C + PP QPDRCALSGNYRLESNP R DLSPL ATGNRI Sbjct: 46 VIVKCKCSMMSNLGCVHEPPVQPDRCALSGNYRLESNPGRPDLSPLGTATGNRI 99 >SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 70.9 bits (166), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP QPDRCALSGNYRLESNPVRHDLSPLAAAT Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAAT 43 >SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 70.9 bits (166), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP QPDRCALSGNYRLESNPVRHDLSPLAAAT Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAAT 43 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 70.1 bits (164), Expect = 2e-12 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = +3 Query: 63 VKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSC 206 V+ PR RFSIGSAPLTSITK DAQ+ GGETRQDYKDTRR C Sbjct: 143 VRGPRQSRFSIGSAPLTSITKSDAQISGGETRQDYKDTRRLHQAGTLC 190 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 70.1 bits (164), Expect = 2e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +3 Query: 105 PLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCA 209 PLTSITK DAQ+ GGETRQDYKDTRRFPL APSCA Sbjct: 119 PLTSITKSDAQISGGETRQDYKDTRRFPLAAPSCA 153 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 68.5 bits (160), Expect = 7e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 445 WLLPVAISRVLPGWTQDDSYRIRRSGRAEXG 353 WLLPVAISRVLPGWTQDDSYRIRRSGRAE G Sbjct: 1 WLLPVAISRVLPGWTQDDSYRIRRSGRAERG 31 >SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 68.5 bits (160), Expect = 7e-12 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP QPDRCALSGNYRLES PVRHDLSPLAAAT Sbjct: 12 PPVQPDRCALSGNYRLESKPVRHDLSPLAAAT 43 >SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) Length = 599 Score = 60.9 bits (141), Expect = 1e-09 Identities = 29/49 (59%), Positives = 33/49 (67%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFL 498 PP Q DRCALSGNYRLESNP RH +PLAAAT + + + G FL Sbjct: 368 PPVQSDRCALSGNYRLESNPERHAKAPLAAATVDIVLMSCLAGALRSFL 416 >SB_51245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 58.8 bits (136), Expect = 5e-09 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = +1 Query: 322 FAPSWAVCTNPPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 FA PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 3 FASKLDCMHEPPVQSDRCALSGNYRLESNPERHAKAPLAAAT 44 >SB_54507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 25 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 56 >SB_58426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_57366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_56245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_55566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_55077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_53790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_52894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_48533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_47211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_46066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_45109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 139 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 170 >SB_43715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_42865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_41269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_40020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_38531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_35148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_31008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_29391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_24808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_23019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_21707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 32 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 63 >SB_19542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_19098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_19031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_17805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_15695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_12040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_9760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_5267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) Length = 108 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 76 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 107 >SB_1707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_1382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_1275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDLSPLAAAT 447 PP Q DRCALSGNYRLESNP RH +PLAAAT Sbjct: 12 PPVQSDRCALSGNYRLESNPERHAKAPLAAAT 43 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 57.6 bits (133), Expect = 1e-08 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -2 Query: 119 DARQGGGAYGKTPATRPFYGSWPFA 45 D QGGGAYGKTPATRPFYGSWPFA Sbjct: 19 DVGQGGGAYGKTPATRPFYGSWPFA 43 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 55.2 bits (127), Expect = 7e-08 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = -2 Query: 113 RQGGGAYGKTPATRPFYGSWPFA 45 ++GGGAYGKTPATRPFYGSWPFA Sbjct: 757 KRGGGAYGKTPATRPFYGSWPFA 779 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 54.8 bits (126), Expect = 9e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -2 Query: 110 QGGGAYGKTPATRPFYGSWPFA 45 +GGGAYGKTPATRPFYGSWPFA Sbjct: 405 EGGGAYGKTPATRPFYGSWPFA 426 >SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 54.8 bits (126), Expect = 9e-08 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNPVRHDL 426 PP QPDRCALSGNYRLESNPVRH L Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHRL 36 Score = 35.9 bits (79), Expect = 0.043 Identities = 20/42 (47%), Positives = 21/42 (50%) Frame = +3 Query: 318 VVRSKLGCVHEXXXXXXXXXXXXXXXXXVQPGKTRLIATGSS 443 VVRSKLGCVHE P + RLIATGSS Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHRLIATGSS 42 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 54.4 bits (125), Expect = 1e-07 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -2 Query: 110 QGGGAYGKTPATRPFYGSWPFA 45 +GGGAYGKTPATRPFYGSWPFA Sbjct: 554 KGGGAYGKTPATRPFYGSWPFA 575 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 54.0 bits (124), Expect = 2e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 107 GGGAYGKTPATRPFYGSWPFA 45 GGGAYGKTPATRPFYGSWPFA Sbjct: 1 GGGAYGKTPATRPFYGSWPFA 21 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 54.0 bits (124), Expect = 2e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 107 GGGAYGKTPATRPFYGSWPFA 45 GGGAYGKTPATRPFYGSWPFA Sbjct: 24 GGGAYGKTPATRPFYGSWPFA 44 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 54.0 bits (124), Expect = 2e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 107 GGGAYGKTPATRPFYGSWPFA 45 GGGAYGKTPATRPFYGSWPFA Sbjct: 1 GGGAYGKTPATRPFYGSWPFA 21 >SB_10421| Best HMM Match : Guanylate_cyc (HMM E-Value=0) Length = 1485 Score = 52.8 bits (121), Expect = 4e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -2 Query: 173 IFIVLSGFATSDLSVDFCDARQGGGAYGKTPATRP 69 I VLSGFAT+DLSV F DA QGGGAYGKT RP Sbjct: 1183 IHTVLSGFATTDLSVRFRDACQGGGAYGKTALPRP 1217 >SB_52929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 364 PDRCALSGNYRLESNPVRHDLSPLAAA 444 PDRCALSGNYRLESNP RH +PLAAA Sbjct: 8 PDRCALSGNYRLESNPERHAKAPLAAA 34 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 52.0 bits (119), Expect = 6e-07 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -2 Query: 164 VLSGFATSDLSVDFCDARQGGGAYGKTPATRP 69 VLSGFAT+DLSV F DA QGGGAYGKT RP Sbjct: 351 VLSGFATTDLSVRFRDACQGGGAYGKTALPRP 382 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 51.6 bits (118), Expect = 8e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 114 SSGGRSLWKNASNAAFLRFLAFC 46 +SGGRSLWKNASNAAFLRFLAFC Sbjct: 57 NSGGRSLWKNASNAAFLRFLAFC 79 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 SGGRSLWKNASNAAFLRFLAFC Sbjct: 16 SGGRSLWKNASNAAFLRFLAFC 37 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 161 LSGFATSDLSVDFCDARQGGGAYGKTPATRP 69 LSGFAT+DLSV F DA QGGGAYGKT RP Sbjct: 2 LSGFATTDLSVRFRDACQGGGAYGKTALPRP 32 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAFC 46 +GGRSLWKNASNAAFLRFLAFC Sbjct: 92 AGGRSLWKNASNAAFLRFLAFC 113 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 111 SGGRSLWKNASNAAFLRFLAF 49 SGGRSLWKNASNAAFLRFLAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAF 36 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 284 MRKRHASRREKGGQVSGKR 228 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) Length = 635 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -2 Query: 164 VLSGFATSDLSVDFCDARQGGGAYGKTPATRP 69 +LSGFA DLSV F DA QGGGAYGKT RP Sbjct: 119 LLSGFAPPDLSVRFRDACQGGGAYGKTALPRP 150 >SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) Length = 75 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 56 PPVQPDRCALSGNYRLESNP 75 >SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 105 GRSLWKNASNAAFLRFLAFC 46 GRSLWKNASNAAFLRFLAFC Sbjct: 2 GRSLWKNASNAAFLRFLAFC 21 >SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 45 PPVQPDRCALSGNYRLESNP 64 >SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 >SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 352 PPXQPDRCALSGNYRLESNP 411 PP QPDRCALSGNYRLESNP Sbjct: 12 PPVQPDRCALSGNYRLESNP 31 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,133,587 Number of Sequences: 59808 Number of extensions: 505615 Number of successful extensions: 2163 Number of sequences better than 10.0: 377 Number of HSP's better than 10.0 without gapping: 1607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2151 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2502612210 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -