BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C22 (886 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 2.3 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 4.1 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.4 bits (53), Expect = 2.3 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -2 Query: 342 RPFQSLVAL--AMSSPTFLGDRPRGPILGAKDDVAPTSPPTHRKFTILISFG 193 RPF S+ L +S+P LG RP+G LG P+ P H + + G Sbjct: 548 RPFFSIPGLPPGLSAPLGLGMRPQGGPLG-----LPSHHPLHPSLGLSMGLG 594 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 4.1 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 340 SQDHCAADSSKQTSPDSCCSLWQQPLSSEPLRSLPGDRKKQKNIKTQRQH 489 S D A ++K SP S QQ + + P KQK + T++QH Sbjct: 364 SVDVLAVHNAKSVSP--LPSYTQQQQQQQQSAAAPPSYWKQKKLPTKKQH 411 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 776,953 Number of Sequences: 2352 Number of extensions: 14459 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95093730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -