BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C21 (861 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.77 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.0 bits (52), Expect = 0.77 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 265 PKTTTLMETATNLSTTVHITWTVPKGRPYFKPTPFPW 375 P+ TT ++T + + +H WT + T PW Sbjct: 1015 PQVTTGVDTGASSTEHMHPDWTTKPSTWWSSTTTSPW 1051 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 265 PKTTTLMETATNLSTTVHITWTV 333 P TT +T T STT T TV Sbjct: 1177 PSTTNHWQTKTTTSTTTRPTTTV 1199 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,370 Number of Sequences: 336 Number of extensions: 3179 Number of successful extensions: 5 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23866870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -