BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C19 (874 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB17E12.05 |rpl3703|rpl37|60S ribosomal protein L37|Schizosac... 55 1e-08 SPCC1223.05c |rpl3702|rpl37-2, rpl37|60S ribosomal protein L37|S... 55 1e-08 >SPAPB17E12.05 |rpl3703|rpl37|60S ribosomal protein L37|Schizosaccharomyces pombe|chr 1|||Manual Length = 89 Score = 55.2 bits (127), Expect = 1e-08 Identities = 25/48 (52%), Positives = 31/48 (64%) Frame = +3 Query: 147 GRXSSHLQXSKCAQCGSPAAKXXSSHWSVXAQRXQPPGTGRMRHLKLV 290 G+ S H+Q S CA CG PAAK S +W A+R + GTGRM +LK V Sbjct: 23 GKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGRMSYLKKV 70 >SPCC1223.05c |rpl3702|rpl37-2, rpl37|60S ribosomal protein L37|Schizosaccharomyces pombe|chr 3|||Manual Length = 91 Score = 55.2 bits (127), Expect = 1e-08 Identities = 25/48 (52%), Positives = 31/48 (64%) Frame = +3 Query: 147 GRXSSHLQXSKCAQCGSPAAKXXSSHWSVXAQRXQPPGTGRMRHLKLV 290 G+ S H+Q S CA CG PAAK S +W A+R + GTGRM +LK V Sbjct: 23 GKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGRMSYLKKV 70 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,486,483 Number of Sequences: 5004 Number of extensions: 15419 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 436477420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -