BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C19 (874 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16080.1 68416.m02032 60S ribosomal protein L37 (RPL37C) simi... 55 7e-08 At1g52300.1 68414.m05901 60S ribosomal protein L37 (RPL37B) simi... 55 7e-08 At1g15250.1 68414.m01825 60S ribosomal protein L37 (RPL37A) almo... 55 7e-08 >At3g16080.1 68416.m02032 60S ribosomal protein L37 (RPL37C) similar to ribosomal protein L37 GB:BAA04888 from [Homo sapiens] Length = 95 Score = 54.8 bits (126), Expect = 7e-08 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = +3 Query: 147 GRXSSHLQXSKCAQCGSPAAKXXSSHWSVXAQRXQPPGTGRMRHLKLV 290 GR S H+Q S+C+ C PAA+ + +WSV A R + GTGRMR+L+ V Sbjct: 23 GRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRNV 70 >At1g52300.1 68414.m05901 60S ribosomal protein L37 (RPL37B) similar to SP:Q43292 from [Arabidopsis thaliana] Length = 95 Score = 54.8 bits (126), Expect = 7e-08 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = +3 Query: 147 GRXSSHLQXSKCAQCGSPAAKXXSSHWSVXAQRXQPPGTGRMRHLKLV 290 GR S H+Q S+C+ C PAA+ + +WSV A R + GTGRMR+L+ V Sbjct: 23 GRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRNV 70 >At1g15250.1 68414.m01825 60S ribosomal protein L37 (RPL37A) almost identical to GB:Q43292 Length = 95 Score = 54.8 bits (126), Expect = 7e-08 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = +3 Query: 147 GRXSSHLQXSKCAQCGSPAAKXXSSHWSVXAQRXQPPGTGRMRHLKLV 290 GR S H+Q S+C+ C PAA+ + +WSV A R + GTGRMR+L+ V Sbjct: 23 GRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRNV 70 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,411,975 Number of Sequences: 28952 Number of extensions: 104543 Number of successful extensions: 130 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2048424000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -