BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C18 (892 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 62 4e-10 SB_7009| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_26779| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_15686| Best HMM Match : DUF1168 (HMM E-Value=0.87) 29 3.8 SB_28307| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/91 (38%), Positives = 62/91 (68%) Frame = +3 Query: 156 LNPQYDAIGKGFVQQYYTLFDDPAQRANLVNMYNVETSFMTFEGVQLQGAVXIMEKLNSL 335 ++ ++ + K FV+ YY++FD + R NL +Y S +TFEG Q+QG I+ KL S+ Sbjct: 113 MSQPFEQVAKQFVEYYYSVFD--SNRNNLAPLYQ-PGSMLTFEGAQIQGTEAIVAKLVSM 169 Query: 336 TFQKITRIVTAVDSQPMFDGGVLINVLGRLK 428 FQ++ ++T+ D+QP+ +GG+++ V+G+LK Sbjct: 170 PFQQVLHVITSQDAQPLPNGGIIVFVMGQLK 200 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 62.5 bits (145), Expect = 4e-10 Identities = 43/127 (33%), Positives = 59/127 (46%), Gaps = 8/127 (6%) Frame = +3 Query: 162 PQYDAIGKGFVQQYYTLFDDPAQRANLVNMYNVETSFM---TFEGVQ---LQGAVXIMEK 323 P +G+ FV+QYYTL + + L Y + F+ G Q + G I EK Sbjct: 6 PSPQCVGREFVRQYYTLLNQ--EPLKLHRFYTKHSWFLHGRAENGPQENPIMGQEAIYEK 63 Query: 324 LNSLTFQKITRIVTAVDSQPMFDGGVLINVLGRLKCDEDPPHLYMQTFVLKPLGD--SFY 497 + L F + VDS GV++ V G L + P +MQTFVL P D +Y Sbjct: 64 IKDLNFVDCRTKILQVDSHSTLGSGVVVQVSGELSNNGQPMRKFMQTFVLAPGEDIRKYY 123 Query: 498 VQHDIFR 518 V +DIFR Sbjct: 124 VHNDIFR 130 >SB_7009| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 439 SSSHFNLPRTLIKTPPSNIGWESTAVTILVIF*KVKLFNFSI 314 + + FN R PPSN+ W AV + ++F VK N+ + Sbjct: 21 NDNFFNQNRKKFGAPPSNLVWALYAVFVGILFSVVKFLNYRL 62 >SB_26779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 611 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 196 NNITHCSMIRLNGQILLICTMLKLHS*PLREYNCRVLL 309 N + H +M+ +G L CT+++ H NCR LL Sbjct: 315 NGVLHTAMLNHDGGFELQCTLVRTHPNSSNIVNCRFLL 352 >SB_15686| Best HMM Match : DUF1168 (HMM E-Value=0.87) Length = 488 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/67 (25%), Positives = 32/67 (47%) Frame = -3 Query: 275 HE*SFNIVHINKICPLSRIIEQCVILLHKTFTDCIVLRIERHLD*DVSICHTNKKPNSSR 96 HE ++VH C +SR+ +C + + +C + R+ + + D + H K + SR Sbjct: 364 HECDDHVVHDQPKCDMSRVYHECDDNVVQDQLECDMSRV--YHECDDHVVHDQLKCDMSR 421 Query: 95 KNSRCDE 75 CD+ Sbjct: 422 VYHECDD 428 >SB_28307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 761 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 267 KFQHCTY*QDLPVEPDHRTMCNIVAQNL 184 KF C Y +++ VE DH+ + IV + L Sbjct: 418 KFDQCVYGREVTVESDHKPLAAIVTKPL 445 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,834,812 Number of Sequences: 59808 Number of extensions: 508040 Number of successful extensions: 816 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2550281014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -