BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C18 (892 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 25 4.1 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 5.4 AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 24 7.1 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 24.6 bits (51), Expect = 4.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 516 GKCRAEHKMNLRVASTRRFACTDVEDLRH 430 GKCR+ H +V F + E++RH Sbjct: 748 GKCRSIHLHRGQVLDADSFRANEQEEIRH 776 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 24.2 bits (50), Expect = 5.4 Identities = 8/39 (20%), Positives = 20/39 (51%) Frame = +3 Query: 333 LTFQKITRIVTAVDSQPMFDGGVLINVLGRLKCDEDPPH 449 LT+ + I+ ++D+ P + + ++V+G + H Sbjct: 149 LTYHQFQAIIASMDAPPQPEAAITLDVIGNANTPQYDDH 187 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 23.8 bits (49), Expect = 7.1 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 192 VQQYYTLFDDPAQRANLVNMYNVET 266 + + YT+FD+ + N+Y VET Sbjct: 529 LNELYTIFDELTDSKSNSNIYKVET 553 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 863,093 Number of Sequences: 2352 Number of extensions: 16341 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95920632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -