BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C17 (904 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.7 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 5.7 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 21 10.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 5.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +2 Query: 314 CVSKEAGHQTSAESW 358 C K+ GH+ S SW Sbjct: 1152 CEEKKPGHKPSTSSW 1166 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 5.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 283 SMSKKLEAALLREQGGWSPNQCRIMGYRTCCRPNS 387 S ++ + L E+ PN CRI G ++ RP++ Sbjct: 231 SSPRRRHSINLLEEDNQKPNVCRICG-KSYARPST 264 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.4 bits (43), Expect = 10.0 Identities = 15/59 (25%), Positives = 21/59 (35%) Frame = +1 Query: 229 RFVFKAPIRPDLVNDVHVSMSKKLEAALLREQGGWSPNQCRIMGYRTCCRPNSSCPWWW 405 + V + P P+ S +LE +E P + YR C RP WW Sbjct: 212 QLVSEHPDSPNSKKSATPSPPPQLEVNERKENLTCQPAVPYVPFYRYCYRPYPVYNQWW 270 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,989 Number of Sequences: 336 Number of extensions: 3800 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25134219 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -