BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C17 (904 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 27 0.59 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 5.5 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 7.3 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 24 7.3 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 9.6 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 27.5 bits (58), Expect = 0.59 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +2 Query: 326 EAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 454 + G Q S+G+G+ +P + G G +SG +FGN +GG Sbjct: 121 QGGGQGGIPSFGSGQQNGGVPFL-GNGQGQSGFPSFGNGQQGG 162 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.2 bits (50), Expect = 5.5 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 466 PHEALAALAPSRQPPNSGERPWQQPL 543 P A + APS PP E P+ +PL Sbjct: 3231 PAAAASGGAPSAMPPIVNEPPYVEPL 3256 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 7.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 496 SRQPPNSGERPWQQPLLLPASQRSFRLEDT 585 +++PP G+ P Q P P SQ+S +T Sbjct: 437 NKEPPRPGQSPTQSP--SPGSQQSLSPANT 464 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.8 bits (49), Expect = 7.3 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -2 Query: 456 RPPRHMLPKAP*PDLWVPPPRTRGIRATARP 364 RPP H P W+ PP R +TA P Sbjct: 93 RPPWHPRPPFGGRPWWLRPPFHRPTTSTAAP 123 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 9.6 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 Query: 101 SGEKDXPPCHGGCE 60 S E+ PPCH CE Sbjct: 152 SPERVCPPCHPSCE 165 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 877,128 Number of Sequences: 2352 Number of extensions: 18469 Number of successful extensions: 33 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97574436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -