BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C13 (863 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21618| Best HMM Match : Yip1 (HMM E-Value=1.1) 28 8.5 SB_4970| Best HMM Match : IBV_3C (HMM E-Value=2.2) 28 8.5 >SB_21618| Best HMM Match : Yip1 (HMM E-Value=1.1) Length = 338 Score = 28.3 bits (60), Expect = 8.5 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 Query: 629 QQSHQRPEPFMLPLPAPTXHAADATGTNPRXPGQP 733 Q +Q P P+M+P P HA NPR PG P Sbjct: 224 QPIYQLPYPYMVPYPYLYSHA-----YNPRYPGYP 253 >SB_4970| Best HMM Match : IBV_3C (HMM E-Value=2.2) Length = 1094 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -2 Query: 268 MFTIDXHGEGITAWKKKQTRKMRXCGSTGGRTACE 164 + T + +G+ W ++Q + CG T G T E Sbjct: 336 LVTSEREVQGMKVWVRRQPKAAEQCGDTNGETELE 370 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,823,715 Number of Sequences: 59808 Number of extensions: 248778 Number of successful extensions: 607 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2467263854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -