BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C06 (862 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 27 4.5 SPAC688.08 |srb8|med12|mediator complex subunit Srb8 |Schizosacc... 26 6.0 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 26.6 bits (56), Expect = 4.5 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +1 Query: 457 ICQSF--LSDKRYIVKLKINKLFCTLXK 534 +C SF L D+R + K+ ++LFC L K Sbjct: 513 VCNSFCLLFDERSLFKIPYHELFCALLK 540 >SPAC688.08 |srb8|med12|mediator complex subunit Srb8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1233 Score = 26.2 bits (55), Expect = 6.0 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -2 Query: 519 K*FIDFQFYNITFITKKTLADXNFKLYLKLNIIMEIQSYTSNCNLITY 376 K FI+F F+NIT +K T L + L I + Y + T+ Sbjct: 706 KDFIEFLFHNITVSSKHTAVIFTSDLLMVLKIALNHPPYFDDLATTTF 753 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,879,668 Number of Sequences: 5004 Number of extensions: 50511 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 428468660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -